Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BX18

Protein Details
Accession A0A0H1BX18   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
57-110IFDKVKKKGGHKGKKPKDKKPKEKKPEDNKPKDNKPKEKKPEDNKPKDNKPKDEBasic
126-153QTESKTLSKKKFKFRGPKKGKGKGKGGGBasic
NLS Segment(s)
PositionSequence
60-153KVKKKGGHKGKKPKDKKPKEKKPEDNKPKDNKPKEKKPEDNKPKDNKPKDEIEKKKGEDKKKDEKEQTESKTLSKKKFKFRGPKKGKGKGKGGG
Subcellular Location(s) extr 7E.R. 7, golg 5, vacu 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MKILPALFAFLAASAVGQSISPPTQADLAPSTQEVTVDEARPIADISARGFGKFKDIFDKVKKKGGHKGKKPKDKKPKEKKPEDNKPKDNKPKEKKPEDNKPKDNKPKDEIEKKKGEDKKKDEKEQTESKTLSKKKFKFRGPKKGKGKGKGGGGGGDVESMGATSPKAPLLFIGGLFILTAPLMIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.08
7 0.08
8 0.09
9 0.1
10 0.11
11 0.13
12 0.13
13 0.16
14 0.15
15 0.16
16 0.16
17 0.16
18 0.16
19 0.14
20 0.14
21 0.12
22 0.15
23 0.16
24 0.16
25 0.16
26 0.15
27 0.15
28 0.15
29 0.14
30 0.09
31 0.08
32 0.08
33 0.09
34 0.15
35 0.15
36 0.16
37 0.16
38 0.16
39 0.22
40 0.22
41 0.22
42 0.23
43 0.25
44 0.31
45 0.4
46 0.49
47 0.45
48 0.51
49 0.54
50 0.51
51 0.58
52 0.63
53 0.64
54 0.65
55 0.74
56 0.77
57 0.83
58 0.88
59 0.89
60 0.89
61 0.9
62 0.91
63 0.91
64 0.92
65 0.92
66 0.94
67 0.94
68 0.93
69 0.94
70 0.93
71 0.92
72 0.9
73 0.88
74 0.87
75 0.87
76 0.85
77 0.85
78 0.83
79 0.83
80 0.84
81 0.85
82 0.85
83 0.83
84 0.85
85 0.86
86 0.86
87 0.85
88 0.83
89 0.84
90 0.85
91 0.83
92 0.78
93 0.71
94 0.7
95 0.69
96 0.72
97 0.69
98 0.67
99 0.67
100 0.63
101 0.67
102 0.65
103 0.65
104 0.65
105 0.65
106 0.69
107 0.71
108 0.77
109 0.76
110 0.74
111 0.72
112 0.71
113 0.67
114 0.63
115 0.55
116 0.5
117 0.52
118 0.53
119 0.55
120 0.56
121 0.59
122 0.63
123 0.71
124 0.77
125 0.79
126 0.83
127 0.86
128 0.85
129 0.88
130 0.88
131 0.89
132 0.88
133 0.85
134 0.82
135 0.77
136 0.73
137 0.68
138 0.58
139 0.49
140 0.41
141 0.34
142 0.26
143 0.2
144 0.14
145 0.08
146 0.07
147 0.06
148 0.05
149 0.04
150 0.04
151 0.05
152 0.06
153 0.09
154 0.09
155 0.09
156 0.1
157 0.14
158 0.15
159 0.14
160 0.15
161 0.12
162 0.12
163 0.12
164 0.12
165 0.07
166 0.05