Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WGS7

Protein Details
Accession B2WGS7   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-67SADPTGERRRRRRKLPEDETCNDBasic
NLS Segment(s)
PositionSequence
52-58RRRRRRK
Subcellular Location(s) plas 5extr 5E.R. 5, mito 4, nucl 3, golg 3
Family & Domain DBs
Amino Acid Sequences MPPHLHPRSRMTTSLFTTTLMVSFLVVAAPHLIPCPVDPRTLADSADPTGERRRRRRKLPEDETCNDIMREERRRRMLLEEKLAARRECPVPKPGGLIGQVLGVQKEGDEEEPRLSIMQRVEKTICQPWGKDDNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.43
3 0.36
4 0.33
5 0.29
6 0.23
7 0.17
8 0.13
9 0.08
10 0.08
11 0.07
12 0.06
13 0.05
14 0.05
15 0.06
16 0.06
17 0.06
18 0.07
19 0.07
20 0.07
21 0.08
22 0.13
23 0.12
24 0.13
25 0.13
26 0.17
27 0.21
28 0.22
29 0.21
30 0.17
31 0.18
32 0.17
33 0.18
34 0.14
35 0.12
36 0.2
37 0.26
38 0.33
39 0.42
40 0.52
41 0.59
42 0.69
43 0.78
44 0.8
45 0.85
46 0.87
47 0.87
48 0.84
49 0.77
50 0.71
51 0.61
52 0.51
53 0.4
54 0.3
55 0.22
56 0.19
57 0.26
58 0.27
59 0.32
60 0.36
61 0.37
62 0.38
63 0.43
64 0.47
65 0.43
66 0.44
67 0.42
68 0.4
69 0.44
70 0.45
71 0.38
72 0.3
73 0.28
74 0.28
75 0.29
76 0.29
77 0.3
78 0.3
79 0.31
80 0.33
81 0.3
82 0.28
83 0.24
84 0.22
85 0.17
86 0.14
87 0.15
88 0.13
89 0.12
90 0.09
91 0.08
92 0.07
93 0.08
94 0.08
95 0.09
96 0.11
97 0.13
98 0.14
99 0.14
100 0.15
101 0.15
102 0.14
103 0.16
104 0.18
105 0.25
106 0.26
107 0.3
108 0.32
109 0.34
110 0.39
111 0.42
112 0.45
113 0.4
114 0.4
115 0.42