Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BQT7

Protein Details
Accession A0A0H1BQT7   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-71TPENQPQRRASPRRRSPRRSRSPSPRTPDPHydrophilic
NLS Segment(s)
PositionSequence
30-66PPPPPPPKGENATPENQPQRRASPRRRSPRRSRSPSP
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MRIEAALYRAGTGPKGADDKSKTGAERGTPPPPPPPKGENATPENQPQRRASPRRRSPRRSRSPSPRTPDPSTLKIVFDEALGRTVLAAHRSKRLTRYQMNPRANWGPMNRASRGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.18
4 0.23
5 0.26
6 0.29
7 0.32
8 0.35
9 0.32
10 0.31
11 0.33
12 0.29
13 0.33
14 0.34
15 0.36
16 0.35
17 0.36
18 0.43
19 0.46
20 0.46
21 0.44
22 0.43
23 0.43
24 0.45
25 0.48
26 0.45
27 0.43
28 0.43
29 0.4
30 0.42
31 0.45
32 0.42
33 0.41
34 0.37
35 0.39
36 0.46
37 0.53
38 0.57
39 0.6
40 0.68
41 0.75
42 0.83
43 0.86
44 0.87
45 0.89
46 0.9
47 0.88
48 0.87
49 0.87
50 0.86
51 0.85
52 0.82
53 0.79
54 0.75
55 0.71
56 0.7
57 0.64
58 0.58
59 0.55
60 0.48
61 0.4
62 0.34
63 0.3
64 0.22
65 0.17
66 0.15
67 0.1
68 0.1
69 0.09
70 0.08
71 0.07
72 0.08
73 0.09
74 0.13
75 0.17
76 0.18
77 0.25
78 0.28
79 0.32
80 0.37
81 0.45
82 0.49
83 0.53
84 0.61
85 0.65
86 0.72
87 0.76
88 0.71
89 0.69
90 0.65
91 0.58
92 0.55
93 0.47
94 0.44
95 0.45
96 0.49
97 0.43