Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BE59

Protein Details
Accession A0A0H1BE59    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
41-70TSATKQPSTPSKPKKKRRRKNLSVSIPPKSHydrophilic
NLS Segment(s)
PositionSequence
50-73PSKPKKKRRRKNLSVSIPPKSPRK
Subcellular Location(s) mito 21, nucl 6
Family & Domain DBs
Amino Acid Sequences MRNYARLRLSWPTFLIYLIPEQPKEQPSKLKTPHQRTTTQTSATKQPSTPSKPKKKRRRKNLSVSIPPKSPRKPTSVTLLAVMQAAIQTCHTARD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.19
4 0.18
5 0.2
6 0.21
7 0.19
8 0.2
9 0.24
10 0.27
11 0.31
12 0.31
13 0.35
14 0.37
15 0.46
16 0.5
17 0.56
18 0.62
19 0.66
20 0.72
21 0.68
22 0.68
23 0.63
24 0.65
25 0.6
26 0.54
27 0.48
28 0.42
29 0.45
30 0.43
31 0.39
32 0.32
33 0.31
34 0.34
35 0.38
36 0.45
37 0.48
38 0.56
39 0.65
40 0.76
41 0.83
42 0.87
43 0.91
44 0.92
45 0.93
46 0.92
47 0.93
48 0.93
49 0.92
50 0.91
51 0.87
52 0.8
53 0.73
54 0.67
55 0.63
56 0.58
57 0.57
58 0.5
59 0.51
60 0.52
61 0.5
62 0.55
63 0.53
64 0.48
65 0.41
66 0.38
67 0.31
68 0.27
69 0.23
70 0.14
71 0.1
72 0.09
73 0.08
74 0.07
75 0.09