Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2VSB5

Protein Details
Accession B2VSB5    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
142-173RDTANKRKREASHKPAKKPTKRRRVVAPSSGVBasic
181-200SPPPKFSLRNRQIKTPARYKHydrophilic
NLS Segment(s)
PositionSequence
91-166AAEKKRSQEAAKVARQQAKIAKDAEQLRQREEKAAKRALKKLQQAATAQKSRDTANKRKREASHKPAKKPTKRRRV
Subcellular Location(s) nucl 13, mito 11, cyto 1, extr 1, pero 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MTTQELGSKATAIPGLSCAKFLTLRWLTRPNLKPNGYPKACTRCDEWHGGAVFYSPRKLASERARKAAELDEAAELQLQKARDREIKAAEAAEKKRSQEAAKVARQQAKIAKDAEQLRQREEKAAKRALKKLQQAATAQKSRDTANKRKREASHKPAKKPTKRRRVVAPSSGVVAGPPEASPPPKFSLRNRQIKTPARYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.18
4 0.19
5 0.17
6 0.18
7 0.2
8 0.19
9 0.26
10 0.27
11 0.3
12 0.35
13 0.41
14 0.42
15 0.5
16 0.58
17 0.57
18 0.6
19 0.6
20 0.61
21 0.62
22 0.7
23 0.62
24 0.58
25 0.57
26 0.57
27 0.57
28 0.52
29 0.49
30 0.45
31 0.47
32 0.5
33 0.44
34 0.4
35 0.37
36 0.35
37 0.3
38 0.24
39 0.22
40 0.17
41 0.17
42 0.12
43 0.12
44 0.14
45 0.16
46 0.23
47 0.3
48 0.4
49 0.42
50 0.49
51 0.49
52 0.46
53 0.47
54 0.41
55 0.33
56 0.23
57 0.21
58 0.15
59 0.14
60 0.14
61 0.13
62 0.1
63 0.08
64 0.09
65 0.09
66 0.1
67 0.11
68 0.14
69 0.18
70 0.21
71 0.24
72 0.25
73 0.26
74 0.25
75 0.24
76 0.24
77 0.25
78 0.24
79 0.26
80 0.25
81 0.24
82 0.25
83 0.27
84 0.24
85 0.24
86 0.29
87 0.32
88 0.35
89 0.4
90 0.42
91 0.46
92 0.45
93 0.43
94 0.4
95 0.35
96 0.33
97 0.29
98 0.27
99 0.26
100 0.29
101 0.33
102 0.35
103 0.34
104 0.34
105 0.37
106 0.35
107 0.37
108 0.39
109 0.39
110 0.4
111 0.47
112 0.49
113 0.51
114 0.57
115 0.58
116 0.6
117 0.6
118 0.6
119 0.56
120 0.55
121 0.52
122 0.53
123 0.54
124 0.5
125 0.44
126 0.4
127 0.37
128 0.34
129 0.39
130 0.4
131 0.42
132 0.48
133 0.57
134 0.59
135 0.66
136 0.71
137 0.73
138 0.76
139 0.76
140 0.76
141 0.76
142 0.81
143 0.83
144 0.87
145 0.88
146 0.88
147 0.89
148 0.89
149 0.88
150 0.85
151 0.85
152 0.85
153 0.84
154 0.81
155 0.76
156 0.66
157 0.59
158 0.54
159 0.42
160 0.32
161 0.24
162 0.16
163 0.11
164 0.09
165 0.09
166 0.11
167 0.15
168 0.17
169 0.2
170 0.25
171 0.31
172 0.36
173 0.43
174 0.52
175 0.59
176 0.67
177 0.67
178 0.72
179 0.75
180 0.8