Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1BB45

Protein Details
Accession A0A0H1BB45    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
48-77LTMTTMMKMKRRSRKNRPKTPPRPMKTSHSHydrophilic
NLS Segment(s)
PositionSequence
55-74KMKRRSRKNRPKTPPRPMKT
Subcellular Location(s) nucl 19.5, mito_nucl 13.166, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MPRRSKSSHARSLNPPAWMPPRSCRVSTPRISNTVDRYRQTRNDPPILTMTTMMKMKRRSRKNRPKTPPRPMKTSHSGPPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.54
3 0.49
4 0.48
5 0.44
6 0.4
7 0.36
8 0.4
9 0.41
10 0.41
11 0.41
12 0.42
13 0.48
14 0.5
15 0.52
16 0.48
17 0.49
18 0.51
19 0.49
20 0.49
21 0.49
22 0.47
23 0.41
24 0.4
25 0.4
26 0.42
27 0.45
28 0.46
29 0.43
30 0.45
31 0.44
32 0.42
33 0.4
34 0.36
35 0.3
36 0.24
37 0.19
38 0.16
39 0.18
40 0.18
41 0.2
42 0.27
43 0.36
44 0.45
45 0.54
46 0.63
47 0.72
48 0.82
49 0.88
50 0.91
51 0.93
52 0.95
53 0.95
54 0.95
55 0.95
56 0.9
57 0.87
58 0.81
59 0.79
60 0.76
61 0.72