Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2VWZ6

Protein Details
Accession B2VWZ6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
32-51TQTLKRVNRVKRPLNSVQQHHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, mito 5
Family & Domain DBs
Amino Acid Sequences MPISLLPASAAAFAPRSNVNVVLASKVEPWLTQTLKRVNRVKRPLNSVQQHTRCLTETLSGPNAIWSLCSIMVPKAPDSELRKDSNPLVEALFNYQLIHIEAYVVHVDMVSQHEVAFKLTPETIEALIEYHKDIYSVDVSASTWEWAEKEQQLKKLQDGFVQAVNRYVFRTGVKALEGLEEDGAGELLEGRGEDVKSAIMGLFLPLLPPPPRIVDVVRPAPLLPSSPGSANWWVPTQHMHQSHSAPIDTWRVVPSTPSPTITTCGETGQTFWSTMGNMGFEAIQLPSPTPSFSQPYNSTSPYAPCTSPYTSSSYYSPPPASAPIPALPLPSVLAQQCGSSAVHGGFGGFGWDTGFAPQYAAFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.16
5 0.17
6 0.17
7 0.2
8 0.21
9 0.2
10 0.19
11 0.19
12 0.18
13 0.18
14 0.18
15 0.14
16 0.17
17 0.22
18 0.24
19 0.27
20 0.34
21 0.42
22 0.48
23 0.56
24 0.62
25 0.64
26 0.71
27 0.77
28 0.79
29 0.77
30 0.8
31 0.8
32 0.81
33 0.8
34 0.78
35 0.78
36 0.74
37 0.71
38 0.64
39 0.57
40 0.49
41 0.43
42 0.35
43 0.28
44 0.25
45 0.25
46 0.26
47 0.23
48 0.21
49 0.21
50 0.2
51 0.16
52 0.14
53 0.1
54 0.09
55 0.09
56 0.1
57 0.1
58 0.11
59 0.14
60 0.15
61 0.16
62 0.16
63 0.16
64 0.22
65 0.27
66 0.33
67 0.35
68 0.38
69 0.38
70 0.4
71 0.41
72 0.4
73 0.35
74 0.28
75 0.24
76 0.21
77 0.2
78 0.2
79 0.19
80 0.14
81 0.13
82 0.12
83 0.12
84 0.12
85 0.11
86 0.08
87 0.07
88 0.07
89 0.08
90 0.08
91 0.07
92 0.06
93 0.06
94 0.06
95 0.06
96 0.09
97 0.09
98 0.08
99 0.08
100 0.1
101 0.11
102 0.12
103 0.12
104 0.09
105 0.1
106 0.1
107 0.1
108 0.1
109 0.11
110 0.1
111 0.09
112 0.09
113 0.08
114 0.08
115 0.09
116 0.08
117 0.07
118 0.07
119 0.07
120 0.07
121 0.08
122 0.09
123 0.09
124 0.08
125 0.07
126 0.08
127 0.08
128 0.09
129 0.07
130 0.06
131 0.06
132 0.06
133 0.07
134 0.1
135 0.12
136 0.19
137 0.22
138 0.29
139 0.34
140 0.35
141 0.38
142 0.4
143 0.38
144 0.34
145 0.33
146 0.28
147 0.26
148 0.26
149 0.22
150 0.2
151 0.19
152 0.17
153 0.15
154 0.14
155 0.11
156 0.11
157 0.13
158 0.1
159 0.11
160 0.11
161 0.11
162 0.1
163 0.1
164 0.1
165 0.08
166 0.07
167 0.06
168 0.05
169 0.05
170 0.04
171 0.03
172 0.03
173 0.02
174 0.02
175 0.02
176 0.02
177 0.03
178 0.04
179 0.04
180 0.04
181 0.05
182 0.05
183 0.05
184 0.05
185 0.05
186 0.03
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.07
194 0.08
195 0.08
196 0.09
197 0.11
198 0.12
199 0.14
200 0.15
201 0.18
202 0.23
203 0.26
204 0.26
205 0.25
206 0.23
207 0.22
208 0.21
209 0.17
210 0.12
211 0.11
212 0.11
213 0.11
214 0.12
215 0.14
216 0.16
217 0.16
218 0.16
219 0.16
220 0.15
221 0.15
222 0.18
223 0.18
224 0.24
225 0.26
226 0.27
227 0.28
228 0.3
229 0.32
230 0.31
231 0.28
232 0.2
233 0.2
234 0.22
235 0.19
236 0.18
237 0.16
238 0.15
239 0.15
240 0.16
241 0.18
242 0.2
243 0.21
244 0.22
245 0.23
246 0.23
247 0.26
248 0.25
249 0.24
250 0.18
251 0.17
252 0.17
253 0.15
254 0.15
255 0.15
256 0.15
257 0.13
258 0.12
259 0.12
260 0.11
261 0.12
262 0.12
263 0.09
264 0.08
265 0.08
266 0.08
267 0.07
268 0.08
269 0.06
270 0.07
271 0.07
272 0.08
273 0.09
274 0.1
275 0.11
276 0.12
277 0.15
278 0.18
279 0.19
280 0.26
281 0.28
282 0.32
283 0.36
284 0.36
285 0.35
286 0.33
287 0.35
288 0.32
289 0.32
290 0.27
291 0.25
292 0.28
293 0.29
294 0.31
295 0.3
296 0.32
297 0.31
298 0.33
299 0.33
300 0.33
301 0.33
302 0.34
303 0.33
304 0.27
305 0.27
306 0.28
307 0.27
308 0.24
309 0.25
310 0.21
311 0.24
312 0.24
313 0.23
314 0.2
315 0.19
316 0.18
317 0.16
318 0.17
319 0.14
320 0.17
321 0.15
322 0.15
323 0.15
324 0.15
325 0.14
326 0.12
327 0.14
328 0.11
329 0.12
330 0.12
331 0.11
332 0.09
333 0.09
334 0.1
335 0.07
336 0.07
337 0.07
338 0.08
339 0.08
340 0.1
341 0.11
342 0.1
343 0.11