Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SEZ1

Protein Details
Accession R7SEZ1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
64-92QKSSPAPSPKTKPKQTRQKPNPKRTKSSSHydrophilic
NLS Segment(s)
PositionSequence
71-90SPKTKPKQTRQKPNPKRTKS
Subcellular Location(s) nucl 25, cyto_nucl 15.5
Family & Domain DBs
KEGG cput:CONPUDRAFT_170153  -  
Amino Acid Sequences MTTTASTTTVQQPHTQMLDPASFNISEGVHSPLPPSQISHYSTLAGALGGQNVSQALQNQSSNQKSSPAPSPKTKPKQTRQKPNPKRTKSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.25
4 0.24
5 0.25
6 0.22
7 0.2
8 0.18
9 0.15
10 0.15
11 0.15
12 0.12
13 0.09
14 0.1
15 0.13
16 0.12
17 0.12
18 0.13
19 0.13
20 0.15
21 0.15
22 0.15
23 0.13
24 0.17
25 0.2
26 0.21
27 0.2
28 0.19
29 0.18
30 0.17
31 0.14
32 0.09
33 0.07
34 0.05
35 0.04
36 0.04
37 0.04
38 0.03
39 0.03
40 0.04
41 0.04
42 0.06
43 0.07
44 0.1
45 0.1
46 0.13
47 0.2
48 0.22
49 0.23
50 0.22
51 0.24
52 0.23
53 0.26
54 0.33
55 0.35
56 0.38
57 0.44
58 0.52
59 0.6
60 0.69
61 0.76
62 0.77
63 0.79
64 0.85
65 0.88
66 0.91
67 0.92
68 0.93
69 0.94
70 0.95
71 0.96
72 0.93