Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MJL0

Protein Details
Accession A0A5M3MJL0   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
89-108EEKIVKPRGRPKKRRVEELSBasic
NLS Segment(s)
PositionSequence
91-103KIVKPRGRPKKRR
Subcellular Location(s) nucl 16, mito 9
Family & Domain DBs
KEGG cput:CONPUDRAFT_167177  -  
Amino Acid Sequences MCGQPQQRALSATGDRVSQPQPQPRLSVTFSRTVEEYLRKKQLGDDPMARVLGPFALRCMKCKGEVMLSSKGVPFDPKHWIKHRARCIEEKIVKPRGRPKKRRVEELSVDEAAPASTVGAPVELSDSLSSKKQRCDATTSAPSCWARERQCEDLSRWQSWDWEELRYPVWAYKDLACNQEDIMELAVDGLPEIAVTNDKKSSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.26
4 0.27
5 0.29
6 0.34
7 0.39
8 0.44
9 0.45
10 0.47
11 0.46
12 0.49
13 0.45
14 0.45
15 0.4
16 0.42
17 0.4
18 0.39
19 0.37
20 0.33
21 0.34
22 0.35
23 0.38
24 0.38
25 0.44
26 0.42
27 0.42
28 0.46
29 0.49
30 0.45
31 0.45
32 0.42
33 0.38
34 0.39
35 0.39
36 0.33
37 0.25
38 0.2
39 0.16
40 0.13
41 0.1
42 0.1
43 0.18
44 0.18
45 0.21
46 0.26
47 0.25
48 0.26
49 0.28
50 0.28
51 0.25
52 0.3
53 0.32
54 0.32
55 0.31
56 0.3
57 0.28
58 0.26
59 0.21
60 0.2
61 0.17
62 0.15
63 0.23
64 0.27
65 0.32
66 0.38
67 0.47
68 0.52
69 0.6
70 0.66
71 0.65
72 0.65
73 0.64
74 0.64
75 0.64
76 0.62
77 0.58
78 0.56
79 0.57
80 0.55
81 0.53
82 0.57
83 0.58
84 0.63
85 0.68
86 0.71
87 0.73
88 0.76
89 0.82
90 0.79
91 0.76
92 0.71
93 0.66
94 0.6
95 0.49
96 0.45
97 0.34
98 0.28
99 0.19
100 0.13
101 0.08
102 0.04
103 0.03
104 0.03
105 0.03
106 0.04
107 0.04
108 0.04
109 0.05
110 0.05
111 0.05
112 0.05
113 0.06
114 0.08
115 0.12
116 0.17
117 0.2
118 0.23
119 0.28
120 0.32
121 0.34
122 0.4
123 0.4
124 0.43
125 0.48
126 0.46
127 0.41
128 0.43
129 0.41
130 0.35
131 0.36
132 0.35
133 0.3
134 0.37
135 0.42
136 0.42
137 0.46
138 0.48
139 0.49
140 0.52
141 0.53
142 0.46
143 0.42
144 0.37
145 0.35
146 0.33
147 0.34
148 0.25
149 0.24
150 0.24
151 0.24
152 0.25
153 0.23
154 0.23
155 0.19
156 0.21
157 0.2
158 0.2
159 0.24
160 0.3
161 0.32
162 0.35
163 0.32
164 0.31
165 0.28
166 0.27
167 0.23
168 0.16
169 0.14
170 0.1
171 0.09
172 0.09
173 0.09
174 0.07
175 0.06
176 0.06
177 0.04
178 0.04
179 0.05
180 0.05
181 0.09
182 0.11
183 0.15