Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3M811

Protein Details
Accession A0A5M3M811   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MTRLTQAPPRPACKRRKRRGARAPMFRIPRAHydrophilic
NLS Segment(s)
PositionSequence
13-24CKRRKRRGARAP
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 7.5, plas 2
Family & Domain DBs
KEGG cput:CONPUDRAFT_159434  -  
Amino Acid Sequences MTRLTQAPPRPACKRRKRRGARAPMFRIPRALCARTLLHRSDDLRWFSDGRLVPIVDDTVNVPRGTDSQDQRVCKYLIGLESFVVASIMTSPSMRHDAVQTYWIMPGSLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.88
4 0.9
5 0.92
6 0.94
7 0.95
8 0.93
9 0.93
10 0.89
11 0.86
12 0.81
13 0.71
14 0.66
15 0.55
16 0.53
17 0.49
18 0.42
19 0.35
20 0.33
21 0.34
22 0.33
23 0.36
24 0.3
25 0.26
26 0.27
27 0.29
28 0.29
29 0.33
30 0.3
31 0.28
32 0.27
33 0.26
34 0.23
35 0.27
36 0.23
37 0.19
38 0.18
39 0.16
40 0.14
41 0.14
42 0.14
43 0.08
44 0.08
45 0.07
46 0.07
47 0.09
48 0.09
49 0.09
50 0.09
51 0.1
52 0.14
53 0.19
54 0.19
55 0.27
56 0.32
57 0.34
58 0.35
59 0.38
60 0.33
61 0.28
62 0.27
63 0.2
64 0.18
65 0.19
66 0.18
67 0.14
68 0.14
69 0.14
70 0.12
71 0.1
72 0.07
73 0.05
74 0.05
75 0.06
76 0.06
77 0.06
78 0.07
79 0.11
80 0.15
81 0.15
82 0.15
83 0.17
84 0.2
85 0.22
86 0.24
87 0.22
88 0.19
89 0.2
90 0.2