Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2W505

Protein Details
Accession B2W505    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
231-250HTDRCVRRIYKSKTGRYQVLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 22, E.R. 2, mito 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009716  Ferroportin-1  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0005381  F:iron ion transmembrane transporter activity  
Pfam View protein in Pfam  
PF06963  FPN1  
Amino Acid Sequences MQQSSHQDAATDPTDPGLRSTLSNIAAHLRPWKDYAQNPAFLASFALSLLYLTVLGFGSQTTTYLLTLDFTSTHVSLMRLASVVIELSATVAAPWLTNKIGAVRAGLWFINEQLFCIALAIGTFVMMDNKAMLAAGALVLGICLSRLGLWGFDLSVQFLVQEDAPKATRGSFSAIEMSLQNLFEMLSFATTMVFYRPKDFKIPIFISAGAIMSSAACFAGFVRKKRGHLLHTDRCVRRIYKSKTGRYQVLPTIEEEIEIDEYTSYGSRHEVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.19
4 0.16
5 0.16
6 0.16
7 0.19
8 0.22
9 0.23
10 0.23
11 0.22
12 0.24
13 0.24
14 0.25
15 0.3
16 0.26
17 0.25
18 0.28
19 0.31
20 0.33
21 0.36
22 0.45
23 0.42
24 0.44
25 0.43
26 0.42
27 0.38
28 0.31
29 0.28
30 0.18
31 0.12
32 0.09
33 0.08
34 0.06
35 0.06
36 0.06
37 0.05
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.06
46 0.06
47 0.07
48 0.07
49 0.08
50 0.08
51 0.08
52 0.09
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.11
59 0.1
60 0.11
61 0.11
62 0.11
63 0.12
64 0.12
65 0.11
66 0.09
67 0.08
68 0.08
69 0.07
70 0.07
71 0.05
72 0.04
73 0.03
74 0.04
75 0.04
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.04
82 0.06
83 0.06
84 0.06
85 0.07
86 0.08
87 0.1
88 0.1
89 0.1
90 0.09
91 0.1
92 0.11
93 0.1
94 0.09
95 0.08
96 0.08
97 0.1
98 0.09
99 0.09
100 0.08
101 0.08
102 0.07
103 0.07
104 0.06
105 0.04
106 0.04
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.03
134 0.03
135 0.04
136 0.04
137 0.04
138 0.05
139 0.06
140 0.06
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.06
147 0.05
148 0.06
149 0.07
150 0.08
151 0.09
152 0.1
153 0.1
154 0.1
155 0.11
156 0.11
157 0.14
158 0.13
159 0.13
160 0.15
161 0.14
162 0.14
163 0.13
164 0.13
165 0.1
166 0.1
167 0.08
168 0.07
169 0.06
170 0.06
171 0.06
172 0.05
173 0.04
174 0.04
175 0.05
176 0.05
177 0.05
178 0.05
179 0.08
180 0.11
181 0.12
182 0.17
183 0.2
184 0.22
185 0.27
186 0.29
187 0.29
188 0.35
189 0.36
190 0.33
191 0.33
192 0.31
193 0.27
194 0.24
195 0.22
196 0.13
197 0.11
198 0.08
199 0.06
200 0.05
201 0.05
202 0.04
203 0.03
204 0.04
205 0.04
206 0.14
207 0.19
208 0.23
209 0.33
210 0.38
211 0.41
212 0.5
213 0.56
214 0.51
215 0.57
216 0.64
217 0.64
218 0.68
219 0.76
220 0.68
221 0.64
222 0.65
223 0.56
224 0.55
225 0.56
226 0.55
227 0.56
228 0.64
229 0.71
230 0.75
231 0.81
232 0.79
233 0.74
234 0.73
235 0.68
236 0.64
237 0.55
238 0.47
239 0.44
240 0.37
241 0.31
242 0.25
243 0.21
244 0.16
245 0.15
246 0.14
247 0.09
248 0.09
249 0.1
250 0.11
251 0.09
252 0.08