Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M3N5K7

Protein Details
Accession A0A5M3N5K7    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-36ILAVPKKKVSHSRKRMRSANKGLKDKHydrophilic
NLS Segment(s)
PositionSequence
16-33KKKVSHSRKRMRSANKGL
Subcellular Location(s) mito 23, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cput:CONPUDRAFT_17616  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences QSLLDLLPPIILAVPKKKVSHSRKRMRSANKGLKDKHNIVNCPACGEAKLAHHMCGNCMSIITRQWRDSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.28
4 0.33
5 0.43
6 0.51
7 0.6
8 0.65
9 0.7
10 0.75
11 0.82
12 0.85
13 0.84
14 0.84
15 0.84
16 0.83
17 0.81
18 0.78
19 0.73
20 0.72
21 0.69
22 0.63
23 0.58
24 0.54
25 0.46
26 0.43
27 0.45
28 0.37
29 0.33
30 0.29
31 0.23
32 0.18
33 0.18
34 0.17
35 0.13
36 0.21
37 0.2
38 0.2
39 0.24
40 0.23
41 0.24
42 0.25
43 0.24
44 0.16
45 0.16
46 0.17
47 0.16
48 0.21
49 0.28
50 0.29
51 0.33