Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M3MIQ2

Protein Details
Accession A0A5M3MIQ2    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-28CPKCHEPQYHDWRKTRGKKKITRCMLTMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9, cyto_mito 9
Family & Domain DBs
KEGG cput:CONPUDRAFT_59041  -  
Amino Acid Sequences CPKCHEPQYHDWRKTRGKKKITRCMLTMMAIGQTIQAMKQHPDMAEKLLYRARATKELF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.79
4 0.79
5 0.8
6 0.86
7 0.88
8 0.87
9 0.8
10 0.71
11 0.66
12 0.57
13 0.49
14 0.39
15 0.28
16 0.19
17 0.14
18 0.12
19 0.07
20 0.06
21 0.05
22 0.04
23 0.06
24 0.07
25 0.09
26 0.12
27 0.14
28 0.15
29 0.18
30 0.19
31 0.21
32 0.24
33 0.22
34 0.23
35 0.24
36 0.25
37 0.24
38 0.29
39 0.31