Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3ME24

Protein Details
Accession A0A5M3ME24   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
65-93RASSPNSRKEKERERTKRRTSASPRRRLEBasic
NLS Segment(s)
PositionSequence
10-93RKPSSLRHASDRPDRTERERERGERGETASGKERERDRERDQSRRTPSDAISLRNRASSPNSRKEKERERTKRRTSASPRRRLE
Subcellular Location(s) nucl 12, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015915  Kelch-typ_b-propeller  
IPR006652  Kelch_1  
KEGG cput:CONPUDRAFT_63912  -  
Pfam View protein in Pfam  
PF01344  Kelch_1  
PF13418  Kelch_4  
PF13854  Kelch_5  
Amino Acid Sequences MPGTPRSAARKPSSLRHASDRPDRTERERERGERGETASGKERERDRERDQSRRTPSDAISLRNRASSPNSRKEKERERTKRRTSASPRRRLEPRLPNDYKAVPVPATNMYWSRAPTHGLLPSRPTRAHTATLVDSTVWLFGGCDERGCCADVWTFDTDSFLFSRPDTQGDPPPPCRAHSATLVDRKIVFFGGGQGPVYYNATWILDTTTHRWIKPTFIIPEGKDPEDYTPAPRRAHTAVLYDNKIWVFGGGNGLQALADLWALDVSGSVDKLKWEKVETGGDEKPSPRGYHTANLVGDIMVVIGGSDGKECFSDVWCLNLRTMWWTRVDSLTKAPSYRRLSHTSTQVGSYLFVIGGHDGSSYSSDVLLYNLVSLQYEPRVIRGRPPTARGYHVALIADSRLFTFGGFNGHDVFDDVHILELAGAAYLPQVMSFAIPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.66
3 0.67
4 0.68
5 0.67
6 0.72
7 0.7
8 0.68
9 0.68
10 0.68
11 0.67
12 0.7
13 0.69
14 0.69
15 0.71
16 0.67
17 0.68
18 0.69
19 0.66
20 0.61
21 0.57
22 0.56
23 0.48
24 0.49
25 0.49
26 0.47
27 0.44
28 0.45
29 0.48
30 0.5
31 0.56
32 0.59
33 0.57
34 0.64
35 0.69
36 0.73
37 0.76
38 0.75
39 0.77
40 0.75
41 0.71
42 0.66
43 0.59
44 0.59
45 0.55
46 0.51
47 0.5
48 0.5
49 0.47
50 0.45
51 0.44
52 0.37
53 0.41
54 0.46
55 0.47
56 0.52
57 0.6
58 0.6
59 0.67
60 0.73
61 0.76
62 0.76
63 0.78
64 0.79
65 0.81
66 0.88
67 0.91
68 0.91
69 0.85
70 0.85
71 0.85
72 0.85
73 0.85
74 0.85
75 0.79
76 0.77
77 0.78
78 0.75
79 0.74
80 0.73
81 0.7
82 0.71
83 0.7
84 0.65
85 0.63
86 0.57
87 0.49
88 0.4
89 0.35
90 0.24
91 0.21
92 0.21
93 0.2
94 0.19
95 0.19
96 0.18
97 0.18
98 0.19
99 0.2
100 0.2
101 0.19
102 0.2
103 0.2
104 0.22
105 0.25
106 0.26
107 0.26
108 0.29
109 0.33
110 0.35
111 0.34
112 0.33
113 0.35
114 0.36
115 0.37
116 0.32
117 0.31
118 0.28
119 0.28
120 0.26
121 0.19
122 0.16
123 0.13
124 0.11
125 0.08
126 0.06
127 0.05
128 0.05
129 0.09
130 0.09
131 0.1
132 0.1
133 0.11
134 0.12
135 0.14
136 0.13
137 0.1
138 0.12
139 0.11
140 0.14
141 0.15
142 0.15
143 0.13
144 0.15
145 0.13
146 0.13
147 0.13
148 0.12
149 0.1
150 0.1
151 0.13
152 0.13
153 0.15
154 0.16
155 0.18
156 0.23
157 0.28
158 0.33
159 0.32
160 0.37
161 0.36
162 0.35
163 0.36
164 0.32
165 0.3
166 0.31
167 0.34
168 0.34
169 0.4
170 0.39
171 0.36
172 0.33
173 0.31
174 0.26
175 0.2
176 0.14
177 0.07
178 0.1
179 0.1
180 0.1
181 0.1
182 0.09
183 0.1
184 0.1
185 0.12
186 0.08
187 0.07
188 0.07
189 0.07
190 0.07
191 0.07
192 0.07
193 0.07
194 0.09
195 0.12
196 0.19
197 0.2
198 0.2
199 0.22
200 0.22
201 0.24
202 0.26
203 0.27
204 0.21
205 0.23
206 0.26
207 0.25
208 0.31
209 0.31
210 0.28
211 0.23
212 0.22
213 0.2
214 0.21
215 0.21
216 0.19
217 0.23
218 0.28
219 0.28
220 0.28
221 0.3
222 0.28
223 0.31
224 0.28
225 0.23
226 0.24
227 0.28
228 0.29
229 0.26
230 0.25
231 0.22
232 0.2
233 0.17
234 0.12
235 0.08
236 0.07
237 0.1
238 0.08
239 0.09
240 0.08
241 0.08
242 0.08
243 0.07
244 0.06
245 0.04
246 0.03
247 0.03
248 0.03
249 0.03
250 0.03
251 0.03
252 0.03
253 0.03
254 0.04
255 0.04
256 0.05
257 0.05
258 0.07
259 0.09
260 0.11
261 0.11
262 0.13
263 0.15
264 0.18
265 0.21
266 0.22
267 0.26
268 0.26
269 0.26
270 0.26
271 0.24
272 0.25
273 0.24
274 0.22
275 0.19
276 0.21
277 0.23
278 0.26
279 0.28
280 0.3
281 0.28
282 0.28
283 0.26
284 0.21
285 0.18
286 0.13
287 0.1
288 0.04
289 0.04
290 0.03
291 0.02
292 0.03
293 0.03
294 0.03
295 0.04
296 0.04
297 0.05
298 0.05
299 0.06
300 0.07
301 0.13
302 0.12
303 0.17
304 0.2
305 0.21
306 0.21
307 0.21
308 0.2
309 0.21
310 0.24
311 0.22
312 0.21
313 0.22
314 0.24
315 0.29
316 0.31
317 0.27
318 0.29
319 0.33
320 0.32
321 0.32
322 0.33
323 0.36
324 0.41
325 0.46
326 0.46
327 0.47
328 0.51
329 0.55
330 0.6
331 0.56
332 0.5
333 0.44
334 0.4
335 0.34
336 0.28
337 0.23
338 0.16
339 0.11
340 0.09
341 0.09
342 0.07
343 0.07
344 0.07
345 0.06
346 0.06
347 0.07
348 0.08
349 0.08
350 0.08
351 0.08
352 0.08
353 0.08
354 0.09
355 0.09
356 0.07
357 0.07
358 0.07
359 0.07
360 0.07
361 0.08
362 0.1
363 0.11
364 0.15
365 0.15
366 0.2
367 0.27
368 0.27
369 0.35
370 0.41
371 0.49
372 0.5
373 0.55
374 0.57
375 0.54
376 0.58
377 0.54
378 0.51
379 0.44
380 0.41
381 0.36
382 0.29
383 0.26
384 0.23
385 0.2
386 0.14
387 0.11
388 0.1
389 0.09
390 0.09
391 0.1
392 0.1
393 0.14
394 0.15
395 0.15
396 0.16
397 0.17
398 0.17
399 0.17
400 0.17
401 0.12
402 0.13
403 0.12
404 0.11
405 0.11
406 0.1
407 0.09
408 0.08
409 0.07
410 0.05
411 0.05
412 0.04
413 0.04
414 0.05
415 0.05
416 0.04
417 0.05
418 0.05