FuNGI

A0A5M3MUY5

Protein Details

Accession

A0A5M3MUY5

Localization Confidence

Medium

Confidence Score

10.1

NoLS Segment(s)

Position	Sequence	Protein Nature
350-373	LGSIGRDKEKKDRRKEKVSDELAS	Basic

NLS Segment(s)

Position	Sequence
351-365	GSIGRDKEKKDRRKE

Subcellular Location(s)

cyto 14.5, cyto_nucl 14.333, nucl 10, cyto_mito 8.332

Family & Domain DBs

InterPro	View protein in InterPro IPR004328 BRO1_dom IPR038499 BRO1_sf IPR037505 pH-resp_palC
Gene Ontology	GO:0071467 P:cellular response to pH
KEGG	cput:CONPUDRAFT_52330 -
Pfam	View protein in Pfam PF03097 BRO1
PROSITE	View protein in PROSITE PS51180 BRO1
CDD	cd09245 BRO1_UmRIM23-like

Amino Acid Sequences

MSVYLYELPTTGAISFSDFCIDESDGRIHTSHLAEATQARANLRSALKESKRTDRDEKDYLKLIKIIDEYLPQLYGIVTCVNADEIRLKAEPVFSWRTTLSANLFNTSPRLSMTSLHADLASSILTYAFALSNLARSTVVSLGMYEYERSIADIERRAKDEKLSFAVTLLCRASGAFEHLSERILMDWDRAMETGLDAGNVRPADLRREVCSALAKVTCADAQSLAIRKLQSKSAYDSTLTPGPPLPRSHPSPSLIAKLHLECASYYSSALSLVLTPGKTKSSKGGNDEINAELRHYLSGEAAFHSALSHKWLGVDAGENGGPSKGGEAVAFLLWAKKELEELKEGAKGLGSIGRDKEKKDRRKEKVSDELASVTVFLKNYKKVNDTLTFQPVPPQMELQSRIPAGRLAVAPKPFAPPPPAFKPSSIERLAEQLDLNGSGSSSLETPSDMTNPRSYAGEGSYF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.12
2	0.13
3	0.12
4	0.14
5	0.14
6	0.14
7	0.17
8	0.18
9	0.16
10	0.19
11	0.21
12	0.19
13	0.2
14	0.2
15	0.18
16	0.21
17	0.21
18	0.19
19	0.18
20	0.17
21	0.18
22	0.19
23	0.22
24	0.21
25	0.21
26	0.2
27	0.21
28	0.22
29	0.26
30	0.27
31	0.27
32	0.29
33	0.37
34	0.42
35	0.49
36	0.53
37	0.57
38	0.61
39	0.65
40	0.7
41	0.68
42	0.7
43	0.7
44	0.69
45	0.64
46	0.66
47	0.62
48	0.55
49	0.49
50	0.42
51	0.37
52	0.33
53	0.3
54	0.23
55	0.23
56	0.22
57	0.2
58	0.2
59	0.15
60	0.14
61	0.12
62	0.1
63	0.09
64	0.08
65	0.07
66	0.07
67	0.07
68	0.08
69	0.08
70	0.09
71	0.11
72	0.11
73	0.14
74	0.14
75	0.14
76	0.14
77	0.16
78	0.16
79	0.19
80	0.25
81	0.22
82	0.25
83	0.24
84	0.24
85	0.23
86	0.25
87	0.22
88	0.23
89	0.23
90	0.23
91	0.23
92	0.22
93	0.24
94	0.22
95	0.19
96	0.13
97	0.15
98	0.14
99	0.15
100	0.19
101	0.23
102	0.23
103	0.23
104	0.22
105	0.19
106	0.18
107	0.17
108	0.12
109	0.05
110	0.05
111	0.04
112	0.05
113	0.05
114	0.05
115	0.05
116	0.05
117	0.06
118	0.06
119	0.09
120	0.09
121	0.1
122	0.09
123	0.09
124	0.1
125	0.1
126	0.11
127	0.08
128	0.08
129	0.08
130	0.09
131	0.1
132	0.08
133	0.07
134	0.08
135	0.07
136	0.08
137	0.08
138	0.09
139	0.12
140	0.18
141	0.23
142	0.25
143	0.28
144	0.3
145	0.3
146	0.33
147	0.33
148	0.3
149	0.29
150	0.28
151	0.25
152	0.23
153	0.26
154	0.21
155	0.2
156	0.17
157	0.13
158	0.11
159	0.11
160	0.11
161	0.08
162	0.11
163	0.09
164	0.09
165	0.11
166	0.11
167	0.12
168	0.11
169	0.11
170	0.08
171	0.08
172	0.08
173	0.07
174	0.07
175	0.07
176	0.08
177	0.08
178	0.08
179	0.06
180	0.06
181	0.07
182	0.06
183	0.06
184	0.05
185	0.05
186	0.08
187	0.08
188	0.08
189	0.09
190	0.09
191	0.13
192	0.17
193	0.19
194	0.19
195	0.21
196	0.21
197	0.21
198	0.23
199	0.19
200	0.17
201	0.16
202	0.14
203	0.11
204	0.12
205	0.11
206	0.09
207	0.09
208	0.06
209	0.07
210	0.09
211	0.11
212	0.11
213	0.12
214	0.13
215	0.15
216	0.16
217	0.19
218	0.2
219	0.2
220	0.23
221	0.24
222	0.24
223	0.23
224	0.22
225	0.21
226	0.22
227	0.2
228	0.16
229	0.16
230	0.16
231	0.18
232	0.19
233	0.21
234	0.22
235	0.28
236	0.31
237	0.33
238	0.34
239	0.35
240	0.35
241	0.35
242	0.31
243	0.27
244	0.25
245	0.22
246	0.22
247	0.18
248	0.17
249	0.12
250	0.13
251	0.13
252	0.11
253	0.11
254	0.08
255	0.08
256	0.07
257	0.08
258	0.06
259	0.04
260	0.05
261	0.07
262	0.07
263	0.07
264	0.08
265	0.12
266	0.12
267	0.13
268	0.18
269	0.24
270	0.28
271	0.32
272	0.38
273	0.37
274	0.38
275	0.39
276	0.34
277	0.29
278	0.25
279	0.2
280	0.14
281	0.12
282	0.11
283	0.09
284	0.09
285	0.07
286	0.07
287	0.08
288	0.08
289	0.08
290	0.08
291	0.08
292	0.08
293	0.08
294	0.07
295	0.1
296	0.1
297	0.09
298	0.1
299	0.1
300	0.1
301	0.1
302	0.11
303	0.08
304	0.09
305	0.09
306	0.08
307	0.09
308	0.08
309	0.08
310	0.06
311	0.06
312	0.06
313	0.06
314	0.06
315	0.06
316	0.07
317	0.07
318	0.08
319	0.07
320	0.08
321	0.08
322	0.09
323	0.09
324	0.08
325	0.12
326	0.14
327	0.17
328	0.18
329	0.2
330	0.2
331	0.22
332	0.22
333	0.19
334	0.16
335	0.13
336	0.11
337	0.13
338	0.12
339	0.13
340	0.16
341	0.24
342	0.26
343	0.29
344	0.39
345	0.46
346	0.55
347	0.63
348	0.71
349	0.72
350	0.81
351	0.86
352	0.85
353	0.85
354	0.81
355	0.72
356	0.64
357	0.56
358	0.45
359	0.37
360	0.29
361	0.19
362	0.15
363	0.13
364	0.14
365	0.17
366	0.22
367	0.27
368	0.31
369	0.33
370	0.34
371	0.42
372	0.43
373	0.44
374	0.44
375	0.47
376	0.44
377	0.41
378	0.44
379	0.4
380	0.38
381	0.35
382	0.31
383	0.26
384	0.31
385	0.35
386	0.31
387	0.33
388	0.31
389	0.3
390	0.29
391	0.27
392	0.21
393	0.21
394	0.21
395	0.19
396	0.24
397	0.26
398	0.27
399	0.27
400	0.3
401	0.28
402	0.3
403	0.32
404	0.32
405	0.37
406	0.44
407	0.48
408	0.46
409	0.46
410	0.48
411	0.48
412	0.51
413	0.46
414	0.39
415	0.35
416	0.38
417	0.38
418	0.34
419	0.28
420	0.21
421	0.2
422	0.19
423	0.18
424	0.13
425	0.11
426	0.09
427	0.1
428	0.09
429	0.08
430	0.09
431	0.08
432	0.09
433	0.11
434	0.12
435	0.17
436	0.2
437	0.23
438	0.27
439	0.28
440	0.29
441	0.29
442	0.28
443	0.26

A0A5M3MUY5

3D AlphaFold-predicted Structure Viewer