Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MUY5

Protein Details
Accession A0A5M3MUY5    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
350-373LGSIGRDKEKKDRRKEKVSDELASBasic
NLS Segment(s)
PositionSequence
351-365GSIGRDKEKKDRRKE
Subcellular Location(s) cyto 14.5, cyto_nucl 14.333, nucl 10, cyto_mito 8.332
Family & Domain DBs
InterPro View protein in InterPro  
IPR004328  BRO1_dom  
IPR038499  BRO1_sf  
IPR037505  pH-resp_palC  
Gene Ontology GO:0071467  P:cellular response to pH  
KEGG cput:CONPUDRAFT_52330  -  
Pfam View protein in Pfam  
PF03097  BRO1  
PROSITE View protein in PROSITE  
PS51180  BRO1  
CDD cd09245  BRO1_UmRIM23-like  
Amino Acid Sequences MSVYLYELPTTGAISFSDFCIDESDGRIHTSHLAEATQARANLRSALKESKRTDRDEKDYLKLIKIIDEYLPQLYGIVTCVNADEIRLKAEPVFSWRTTLSANLFNTSPRLSMTSLHADLASSILTYAFALSNLARSTVVSLGMYEYERSIADIERRAKDEKLSFAVTLLCRASGAFEHLSERILMDWDRAMETGLDAGNVRPADLRREVCSALAKVTCADAQSLAIRKLQSKSAYDSTLTPGPPLPRSHPSPSLIAKLHLECASYYSSALSLVLTPGKTKSSKGGNDEINAELRHYLSGEAAFHSALSHKWLGVDAGENGGPSKGGEAVAFLLWAKKELEELKEGAKGLGSIGRDKEKKDRRKEKVSDELASVTVFLKNYKKVNDTLTFQPVPPQMELQSRIPAGRLAVAPKPFAPPPPAFKPSSIERLAEQLDLNGSGSSSLETPSDMTNPRSYAGEGSYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.14
5 0.14
6 0.14
7 0.17
8 0.18
9 0.16
10 0.19
11 0.21
12 0.19
13 0.2
14 0.2
15 0.18
16 0.21
17 0.21
18 0.19
19 0.18
20 0.17
21 0.18
22 0.19
23 0.22
24 0.21
25 0.21
26 0.2
27 0.21
28 0.22
29 0.26
30 0.27
31 0.27
32 0.29
33 0.37
34 0.42
35 0.49
36 0.53
37 0.57
38 0.61
39 0.65
40 0.7
41 0.68
42 0.7
43 0.7
44 0.69
45 0.64
46 0.66
47 0.62
48 0.55
49 0.49
50 0.42
51 0.37
52 0.33
53 0.3
54 0.23
55 0.23
56 0.22
57 0.2
58 0.2
59 0.15
60 0.14
61 0.12
62 0.1
63 0.09
64 0.08
65 0.07
66 0.07
67 0.07
68 0.08
69 0.08
70 0.09
71 0.11
72 0.11
73 0.14
74 0.14
75 0.14
76 0.14
77 0.16
78 0.16
79 0.19
80 0.25
81 0.22
82 0.25
83 0.24
84 0.24
85 0.23
86 0.25
87 0.22
88 0.23
89 0.23
90 0.23
91 0.23
92 0.22
93 0.24
94 0.22
95 0.19
96 0.13
97 0.15
98 0.14
99 0.15
100 0.19
101 0.23
102 0.23
103 0.23
104 0.22
105 0.19
106 0.18
107 0.17
108 0.12
109 0.05
110 0.05
111 0.04
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.06
119 0.09
120 0.09
121 0.1
122 0.09
123 0.09
124 0.1
125 0.1
126 0.11
127 0.08
128 0.08
129 0.08
130 0.09
131 0.1
132 0.08
133 0.07
134 0.08
135 0.07
136 0.08
137 0.08
138 0.09
139 0.12
140 0.18
141 0.23
142 0.25
143 0.28
144 0.3
145 0.3
146 0.33
147 0.33
148 0.3
149 0.29
150 0.28
151 0.25
152 0.23
153 0.26
154 0.21
155 0.2
156 0.17
157 0.13
158 0.11
159 0.11
160 0.11
161 0.08
162 0.11
163 0.09
164 0.09
165 0.11
166 0.11
167 0.12
168 0.11
169 0.11
170 0.08
171 0.08
172 0.08
173 0.07
174 0.07
175 0.07
176 0.08
177 0.08
178 0.08
179 0.06
180 0.06
181 0.07
182 0.06
183 0.06
184 0.05
185 0.05
186 0.08
187 0.08
188 0.08
189 0.09
190 0.09
191 0.13
192 0.17
193 0.19
194 0.19
195 0.21
196 0.21
197 0.21
198 0.23
199 0.19
200 0.17
201 0.16
202 0.14
203 0.11
204 0.12
205 0.11
206 0.09
207 0.09
208 0.06
209 0.07
210 0.09
211 0.11
212 0.11
213 0.12
214 0.13
215 0.15
216 0.16
217 0.19
218 0.2
219 0.2
220 0.23
221 0.24
222 0.24
223 0.23
224 0.22
225 0.21
226 0.22
227 0.2
228 0.16
229 0.16
230 0.16
231 0.18
232 0.19
233 0.21
234 0.22
235 0.28
236 0.31
237 0.33
238 0.34
239 0.35
240 0.35
241 0.35
242 0.31
243 0.27
244 0.25
245 0.22
246 0.22
247 0.18
248 0.17
249 0.12
250 0.13
251 0.13
252 0.11
253 0.11
254 0.08
255 0.08
256 0.07
257 0.08
258 0.06
259 0.04
260 0.05
261 0.07
262 0.07
263 0.07
264 0.08
265 0.12
266 0.12
267 0.13
268 0.18
269 0.24
270 0.28
271 0.32
272 0.38
273 0.37
274 0.38
275 0.39
276 0.34
277 0.29
278 0.25
279 0.2
280 0.14
281 0.12
282 0.11
283 0.09
284 0.09
285 0.07
286 0.07
287 0.08
288 0.08
289 0.08
290 0.08
291 0.08
292 0.08
293 0.08
294 0.07
295 0.1
296 0.1
297 0.09
298 0.1
299 0.1
300 0.1
301 0.1
302 0.11
303 0.08
304 0.09
305 0.09
306 0.08
307 0.09
308 0.08
309 0.08
310 0.06
311 0.06
312 0.06
313 0.06
314 0.06
315 0.06
316 0.07
317 0.07
318 0.08
319 0.07
320 0.08
321 0.08
322 0.09
323 0.09
324 0.08
325 0.12
326 0.14
327 0.17
328 0.18
329 0.2
330 0.2
331 0.22
332 0.22
333 0.19
334 0.16
335 0.13
336 0.11
337 0.13
338 0.12
339 0.13
340 0.16
341 0.24
342 0.26
343 0.29
344 0.39
345 0.46
346 0.55
347 0.63
348 0.71
349 0.72
350 0.81
351 0.86
352 0.85
353 0.85
354 0.81
355 0.72
356 0.64
357 0.56
358 0.45
359 0.37
360 0.29
361 0.19
362 0.15
363 0.13
364 0.14
365 0.17
366 0.22
367 0.27
368 0.31
369 0.33
370 0.34
371 0.42
372 0.43
373 0.44
374 0.44
375 0.47
376 0.44
377 0.41
378 0.44
379 0.4
380 0.38
381 0.35
382 0.31
383 0.26
384 0.31
385 0.35
386 0.31
387 0.33
388 0.31
389 0.3
390 0.29
391 0.27
392 0.21
393 0.21
394 0.21
395 0.19
396 0.24
397 0.26
398 0.27
399 0.27
400 0.3
401 0.28
402 0.3
403 0.32
404 0.32
405 0.37
406 0.44
407 0.48
408 0.46
409 0.46
410 0.48
411 0.48
412 0.51
413 0.46
414 0.39
415 0.35
416 0.38
417 0.38
418 0.34
419 0.28
420 0.21
421 0.2
422 0.19
423 0.18
424 0.13
425 0.11
426 0.09
427 0.1
428 0.09
429 0.08
430 0.09
431 0.08
432 0.09
433 0.11
434 0.12
435 0.17
436 0.2
437 0.23
438 0.27
439 0.28
440 0.29
441 0.29
442 0.28
443 0.26