Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M3MSV3

Protein Details
Accession A0A5M3MSV3    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-35TSGGGKAAKKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
7-29APTSGGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 12, cyto 8, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG cput:CONPUDRAFT_89622  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAPTSGGGKAAKKKKWSKGKVKDKAQHAVVLDKPTFDRIFKEAPTWRLISQSILIERLKINGSLARVAIRHLERENLIKRIVHHSGQLVYTRVTAATD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.45
3 0.48
4 0.53
5 0.61
6 0.65
7 0.75
8 0.8
9 0.82
10 0.84
11 0.9
12 0.9
13 0.91
14 0.88
15 0.84
16 0.81
17 0.71
18 0.63
19 0.53
20 0.48
21 0.4
22 0.37
23 0.3
24 0.24
25 0.22
26 0.22
27 0.22
28 0.17
29 0.17
30 0.15
31 0.18
32 0.18
33 0.22
34 0.22
35 0.24
36 0.26
37 0.25
38 0.22
39 0.22
40 0.21
41 0.17
42 0.15
43 0.15
44 0.13
45 0.14
46 0.14
47 0.13
48 0.13
49 0.14
50 0.13
51 0.11
52 0.12
53 0.11
54 0.12
55 0.12
56 0.13
57 0.13
58 0.12
59 0.13
60 0.18
61 0.17
62 0.19
63 0.19
64 0.21
65 0.22
66 0.3
67 0.33
68 0.3
69 0.31
70 0.29
71 0.31
72 0.35
73 0.38
74 0.32
75 0.3
76 0.31
77 0.31
78 0.32
79 0.33
80 0.27
81 0.23
82 0.22
83 0.2