Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WHD8

Protein Details
Accession B2WHD8   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
49-75HRHVYIHPSKGKKRKRNIKPDKDVSTMBasic
NLS Segment(s)
PositionSequence
57-67SKGKKRKRNIK
Subcellular Location(s) mito 14.5, mito_nucl 10.666, cyto_nucl 6.833, cyto 6, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0006364  P:rRNA processing  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF08228  RNase_P_pop3  
Amino Acid Sequences MAPTTKQNSKPVFKTASPFTETKWPEISQDDEDVILELLCNLVTPLGDHRHVYIHPSKGKKRKRNIKPDKDVSTMADTPPPPPEISNHLLVGLNSVTRHLEALAAKTAPSTAPVTNKSPESMHANMKSAPVSDSETNVLSPLSMVILTHPKPTLSPAHAHLPTLVHLATLPPASTASRTANVETRLIALPTSADARLASALGIPRAGALAIYQGAPGAKTLEDYVREHIGVTQCPWIDEAMSAEWKGLNVKSEIPGTNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.57
3 0.54
4 0.51
5 0.47
6 0.42
7 0.45
8 0.44
9 0.42
10 0.4
11 0.35
12 0.33
13 0.36
14 0.37
15 0.3
16 0.3
17 0.27
18 0.22
19 0.21
20 0.19
21 0.16
22 0.11
23 0.08
24 0.05
25 0.05
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.05
32 0.1
33 0.14
34 0.16
35 0.17
36 0.18
37 0.21
38 0.21
39 0.27
40 0.28
41 0.32
42 0.37
43 0.46
44 0.54
45 0.61
46 0.72
47 0.75
48 0.8
49 0.83
50 0.86
51 0.89
52 0.91
53 0.93
54 0.92
55 0.92
56 0.87
57 0.8
58 0.7
59 0.62
60 0.56
61 0.46
62 0.36
63 0.32
64 0.26
65 0.23
66 0.24
67 0.23
68 0.17
69 0.16
70 0.18
71 0.2
72 0.22
73 0.23
74 0.21
75 0.2
76 0.2
77 0.19
78 0.19
79 0.13
80 0.1
81 0.08
82 0.08
83 0.08
84 0.07
85 0.08
86 0.06
87 0.08
88 0.08
89 0.1
90 0.11
91 0.11
92 0.11
93 0.1
94 0.11
95 0.08
96 0.09
97 0.1
98 0.1
99 0.13
100 0.16
101 0.19
102 0.21
103 0.21
104 0.21
105 0.19
106 0.19
107 0.21
108 0.21
109 0.24
110 0.23
111 0.24
112 0.24
113 0.24
114 0.22
115 0.17
116 0.15
117 0.11
118 0.13
119 0.11
120 0.12
121 0.12
122 0.12
123 0.12
124 0.11
125 0.1
126 0.06
127 0.06
128 0.05
129 0.04
130 0.03
131 0.03
132 0.04
133 0.1
134 0.11
135 0.12
136 0.13
137 0.13
138 0.13
139 0.16
140 0.19
141 0.16
142 0.18
143 0.19
144 0.26
145 0.26
146 0.26
147 0.25
148 0.21
149 0.2
150 0.19
151 0.16
152 0.08
153 0.08
154 0.08
155 0.08
156 0.08
157 0.07
158 0.06
159 0.07
160 0.07
161 0.08
162 0.11
163 0.12
164 0.15
165 0.16
166 0.18
167 0.21
168 0.23
169 0.22
170 0.2
171 0.2
172 0.18
173 0.17
174 0.15
175 0.1
176 0.09
177 0.09
178 0.11
179 0.08
180 0.08
181 0.07
182 0.08
183 0.09
184 0.08
185 0.07
186 0.07
187 0.09
188 0.09
189 0.09
190 0.08
191 0.07
192 0.08
193 0.07
194 0.05
195 0.04
196 0.05
197 0.06
198 0.06
199 0.06
200 0.07
201 0.07
202 0.07
203 0.08
204 0.07
205 0.07
206 0.08
207 0.1
208 0.13
209 0.16
210 0.18
211 0.22
212 0.23
213 0.23
214 0.22
215 0.25
216 0.24
217 0.23
218 0.23
219 0.25
220 0.22
221 0.23
222 0.23
223 0.19
224 0.16
225 0.15
226 0.16
227 0.14
228 0.16
229 0.16
230 0.15
231 0.15
232 0.15
233 0.18
234 0.17
235 0.17
236 0.16
237 0.19
238 0.22
239 0.27