Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MGY8

Protein Details
Accession A0A5M3MGY8   
Localization Confidence High
Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-74KDEEARRLRREEKKKEKEKRREKVAADKAPBasic
177-200MASLLPRQRKKRYAARKGWKGWVEHydrophilic
NLS Segment(s)
PositionSequence
50-68RRLRREEKKKEKEKRREKV
184-194QRKKRYAARKG
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
KEGG cput:CONPUDRAFT_83804  -  
Amino Acid Sequences MYSHPLAYKRARRTATNVLAGDFDPRPTRDVLTSVLNIGSYASEKDEEARRLRREEKKKEKEKRREKVAADKAPETDSATSGAPLPQAPQNTTMPAPPPRQSQPHSFWRSSNTSRAPSDRPTIQIATLQRPRSVTPPPMPSSPQSTPGPSSPGGTSRTSSKRPHTPDDDEDLNSSFMASLLPRQRKKRYAARKGWKGWVEVDEDETPTSDKLIKLDSVSVLKERRTRSGKSFDAIGLGKDTWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.67
3 0.66
4 0.58
5 0.5
6 0.47
7 0.43
8 0.39
9 0.29
10 0.24
11 0.2
12 0.2
13 0.22
14 0.22
15 0.24
16 0.21
17 0.23
18 0.23
19 0.24
20 0.23
21 0.22
22 0.21
23 0.18
24 0.16
25 0.14
26 0.12
27 0.08
28 0.08
29 0.09
30 0.09
31 0.1
32 0.14
33 0.2
34 0.24
35 0.3
36 0.37
37 0.4
38 0.45
39 0.55
40 0.61
41 0.65
42 0.71
43 0.76
44 0.79
45 0.86
46 0.9
47 0.92
48 0.93
49 0.94
50 0.92
51 0.91
52 0.89
53 0.83
54 0.83
55 0.82
56 0.78
57 0.71
58 0.63
59 0.54
60 0.46
61 0.42
62 0.33
63 0.24
64 0.17
65 0.15
66 0.13
67 0.12
68 0.11
69 0.11
70 0.09
71 0.08
72 0.1
73 0.11
74 0.12
75 0.13
76 0.16
77 0.16
78 0.18
79 0.18
80 0.18
81 0.18
82 0.23
83 0.25
84 0.24
85 0.28
86 0.3
87 0.35
88 0.37
89 0.41
90 0.41
91 0.48
92 0.51
93 0.48
94 0.45
95 0.45
96 0.48
97 0.43
98 0.44
99 0.37
100 0.35
101 0.36
102 0.38
103 0.36
104 0.32
105 0.33
106 0.28
107 0.26
108 0.25
109 0.24
110 0.21
111 0.22
112 0.2
113 0.24
114 0.28
115 0.27
116 0.25
117 0.26
118 0.27
119 0.26
120 0.29
121 0.27
122 0.27
123 0.32
124 0.33
125 0.34
126 0.35
127 0.33
128 0.37
129 0.32
130 0.33
131 0.28
132 0.27
133 0.27
134 0.26
135 0.28
136 0.21
137 0.21
138 0.17
139 0.19
140 0.2
141 0.19
142 0.19
143 0.23
144 0.28
145 0.32
146 0.37
147 0.4
148 0.46
149 0.5
150 0.57
151 0.57
152 0.57
153 0.56
154 0.56
155 0.52
156 0.44
157 0.4
158 0.34
159 0.27
160 0.21
161 0.16
162 0.1
163 0.08
164 0.07
165 0.06
166 0.11
167 0.19
168 0.29
169 0.35
170 0.43
171 0.52
172 0.59
173 0.67
174 0.71
175 0.74
176 0.76
177 0.8
178 0.83
179 0.85
180 0.84
181 0.85
182 0.77
183 0.68
184 0.61
185 0.53
186 0.46
187 0.37
188 0.35
189 0.28
190 0.25
191 0.23
192 0.21
193 0.19
194 0.14
195 0.15
196 0.13
197 0.13
198 0.13
199 0.16
200 0.17
201 0.17
202 0.19
203 0.21
204 0.21
205 0.23
206 0.27
207 0.27
208 0.31
209 0.36
210 0.37
211 0.44
212 0.47
213 0.51
214 0.53
215 0.6
216 0.59
217 0.55
218 0.55
219 0.45
220 0.46
221 0.4
222 0.33
223 0.27