Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SCE3

Protein Details
Accession R7SCE3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
141-190PEELRDKKRKVKAEKKDGREKKRARAGALDVKGKKARVGTKKKDAPKVGTBasic
NLS Segment(s)
PositionSequence
145-187RDKKRKVKAEKKDGREKKRARAGALDVKGKKARVGTKKKDAPK
Subcellular Location(s) cyto_nucl 10.333, nucl 10, cyto_mito 8.666, cyto 8.5, mito 7.5
Family & Domain DBs
KEGG cput:CONPUDRAFT_57504  -  
cput:CONPUDRAFT_68301  -  
Amino Acid Sequences KLAVRLRKFGALPQDSPWKHDKFLQALRYQLMSDDEDGWDAEKGKKTNHFVSRAPVYRSKLLNDFLAAVDTIPDPNGKPSYVLRVRGEPKEQEVPVITDISSRTRRWMVDMEWLSQPENKKWDVESRITGNGKVWGDDDDPEELRDKKRKVKAEKKDGREKKRARAGALDVKGKKARVGTKKKDAPKVGTSKSAAAIDVASSDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.45
3 0.48
4 0.51
5 0.43
6 0.4
7 0.43
8 0.45
9 0.43
10 0.51
11 0.54
12 0.5
13 0.5
14 0.5
15 0.45
16 0.38
17 0.31
18 0.26
19 0.2
20 0.18
21 0.17
22 0.15
23 0.14
24 0.14
25 0.14
26 0.12
27 0.12
28 0.15
29 0.19
30 0.2
31 0.24
32 0.31
33 0.36
34 0.44
35 0.49
36 0.5
37 0.47
38 0.52
39 0.56
40 0.54
41 0.53
42 0.5
43 0.47
44 0.47
45 0.48
46 0.44
47 0.39
48 0.37
49 0.33
50 0.27
51 0.24
52 0.18
53 0.17
54 0.13
55 0.09
56 0.08
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.09
63 0.11
64 0.1
65 0.11
66 0.12
67 0.21
68 0.24
69 0.29
70 0.27
71 0.33
72 0.37
73 0.38
74 0.41
75 0.33
76 0.33
77 0.33
78 0.32
79 0.26
80 0.23
81 0.21
82 0.18
83 0.17
84 0.13
85 0.09
86 0.1
87 0.14
88 0.17
89 0.15
90 0.17
91 0.19
92 0.19
93 0.21
94 0.23
95 0.19
96 0.25
97 0.26
98 0.26
99 0.25
100 0.25
101 0.23
102 0.23
103 0.23
104 0.17
105 0.19
106 0.17
107 0.17
108 0.18
109 0.24
110 0.26
111 0.27
112 0.28
113 0.28
114 0.33
115 0.33
116 0.32
117 0.26
118 0.27
119 0.24
120 0.21
121 0.19
122 0.15
123 0.15
124 0.16
125 0.16
126 0.14
127 0.14
128 0.14
129 0.16
130 0.16
131 0.21
132 0.28
133 0.31
134 0.38
135 0.45
136 0.54
137 0.62
138 0.71
139 0.76
140 0.8
141 0.85
142 0.85
143 0.88
144 0.89
145 0.87
146 0.87
147 0.83
148 0.81
149 0.82
150 0.77
151 0.69
152 0.66
153 0.64
154 0.63
155 0.61
156 0.6
157 0.51
158 0.53
159 0.53
160 0.47
161 0.42
162 0.39
163 0.43
164 0.46
165 0.55
166 0.59
167 0.66
168 0.75
169 0.81
170 0.84
171 0.81
172 0.77
173 0.76
174 0.76
175 0.69
176 0.68
177 0.62
178 0.54
179 0.51
180 0.45
181 0.35
182 0.27
183 0.23
184 0.16
185 0.14