Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MKL8

Protein Details
Accession A0A5M3MKL8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
155-176EKERIKAEKEKAKSGKKKNGKSBasic
NLS Segment(s)
PositionSequence
155-176EKERIKAEKEKAKSGKKKNGKS
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR023139  PBDC1-like_dom_sf  
IPR008476  PBDC1_metazoa/fungi  
KEGG cput:CONPUDRAFT_106467  -  
Pfam View protein in Pfam  
PF04669  Polysacc_synt_4  
Amino Acid Sequences MAQQRFDPNNAQNLIEIEKQFAVKAVEQAQTYWHLLEKVHPSDLKLTKLDDEIYEHTMSTFPEFAENDHAKLIKLDEDFLKSEDGKKRWRDFIQSYEKKVKDYNFGSLIRTDARNEYSETNTIFVTRIQFYAVEISRNRLGLNDKAHEIAKEEAEKERIKAEKEKAKSGKKKNGKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.27
4 0.21
5 0.21
6 0.21
7 0.19
8 0.2
9 0.18
10 0.16
11 0.19
12 0.21
13 0.23
14 0.23
15 0.24
16 0.23
17 0.24
18 0.24
19 0.2
20 0.17
21 0.14
22 0.14
23 0.2
24 0.25
25 0.24
26 0.27
27 0.27
28 0.27
29 0.35
30 0.38
31 0.36
32 0.3
33 0.28
34 0.26
35 0.27
36 0.26
37 0.18
38 0.19
39 0.18
40 0.2
41 0.19
42 0.17
43 0.16
44 0.15
45 0.15
46 0.13
47 0.11
48 0.07
49 0.1
50 0.1
51 0.11
52 0.18
53 0.19
54 0.18
55 0.18
56 0.19
57 0.16
58 0.16
59 0.16
60 0.11
61 0.11
62 0.11
63 0.11
64 0.13
65 0.14
66 0.14
67 0.15
68 0.12
69 0.17
70 0.22
71 0.24
72 0.29
73 0.35
74 0.38
75 0.43
76 0.44
77 0.46
78 0.43
79 0.48
80 0.53
81 0.5
82 0.52
83 0.54
84 0.53
85 0.47
86 0.47
87 0.4
88 0.37
89 0.34
90 0.34
91 0.3
92 0.3
93 0.3
94 0.27
95 0.27
96 0.21
97 0.2
98 0.17
99 0.14
100 0.16
101 0.16
102 0.18
103 0.19
104 0.19
105 0.21
106 0.2
107 0.18
108 0.16
109 0.15
110 0.14
111 0.13
112 0.13
113 0.12
114 0.12
115 0.12
116 0.12
117 0.12
118 0.18
119 0.17
120 0.19
121 0.18
122 0.22
123 0.23
124 0.24
125 0.23
126 0.19
127 0.23
128 0.24
129 0.29
130 0.28
131 0.28
132 0.29
133 0.3
134 0.28
135 0.27
136 0.24
137 0.22
138 0.22
139 0.22
140 0.24
141 0.29
142 0.3
143 0.28
144 0.32
145 0.32
146 0.33
147 0.4
148 0.45
149 0.5
150 0.53
151 0.62
152 0.65
153 0.72
154 0.78
155 0.81
156 0.82