Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3N1H4

Protein Details
Accession A0A5M3N1H4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
250-274VTFLYVEKRRRDKERAAKRDIRWNFHydrophilic
NLS Segment(s)
PositionSequence
257-268KRRRDKERAAKR
Subcellular Location(s) nucl 11.5, cyto_nucl 11, cyto 9.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046528  DUF6593  
KEGG cput:CONPUDRAFT_162196  -  
Pfam View protein in Pfam  
PF20236  DUF6593  
Amino Acid Sequences MRFYFSTDHVRNSIVTNDHAQVVYKIDTPFKFLWQKGVSTIWKIAPSSEPISFGQGINSADAEELDPDPRDDDGAAFLEADAAGDDAKIRSPSQEPDGSEGDSASASDGEELARSATEEFDMQDRFVKLATVEWRHINSTTIKWLGANGFGTSEVATKDLLKSITWTNRRRVFTGCDGRTYEWELAFHVCKLYLVDGVQKTRIARYHRYKSVLVHGKDSRSGYLEFDDEELTKAFGQPHISSDLLDMLLVTFLYVEKRRRDKERAAKRDIRWNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.26
4 0.26
5 0.27
6 0.26
7 0.25
8 0.2
9 0.21
10 0.2
11 0.2
12 0.2
13 0.25
14 0.25
15 0.3
16 0.3
17 0.34
18 0.39
19 0.35
20 0.43
21 0.39
22 0.4
23 0.37
24 0.42
25 0.38
26 0.34
27 0.37
28 0.31
29 0.31
30 0.3
31 0.29
32 0.25
33 0.27
34 0.27
35 0.25
36 0.25
37 0.22
38 0.26
39 0.26
40 0.23
41 0.19
42 0.18
43 0.18
44 0.15
45 0.15
46 0.11
47 0.1
48 0.1
49 0.09
50 0.08
51 0.08
52 0.09
53 0.09
54 0.09
55 0.1
56 0.1
57 0.1
58 0.09
59 0.08
60 0.09
61 0.09
62 0.09
63 0.08
64 0.08
65 0.08
66 0.07
67 0.07
68 0.05
69 0.04
70 0.03
71 0.03
72 0.04
73 0.04
74 0.06
75 0.07
76 0.07
77 0.1
78 0.12
79 0.15
80 0.2
81 0.23
82 0.23
83 0.26
84 0.27
85 0.25
86 0.23
87 0.2
88 0.15
89 0.11
90 0.1
91 0.06
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.08
108 0.08
109 0.08
110 0.11
111 0.11
112 0.1
113 0.1
114 0.1
115 0.08
116 0.11
117 0.15
118 0.15
119 0.17
120 0.18
121 0.19
122 0.2
123 0.2
124 0.19
125 0.16
126 0.14
127 0.16
128 0.15
129 0.14
130 0.13
131 0.14
132 0.12
133 0.12
134 0.11
135 0.08
136 0.07
137 0.07
138 0.08
139 0.07
140 0.07
141 0.06
142 0.06
143 0.06
144 0.06
145 0.07
146 0.08
147 0.09
148 0.08
149 0.1
150 0.14
151 0.23
152 0.31
153 0.35
154 0.41
155 0.48
156 0.51
157 0.5
158 0.49
159 0.46
160 0.47
161 0.53
162 0.46
163 0.42
164 0.42
165 0.41
166 0.4
167 0.38
168 0.3
169 0.2
170 0.2
171 0.17
172 0.17
173 0.17
174 0.16
175 0.12
176 0.1
177 0.1
178 0.1
179 0.1
180 0.09
181 0.08
182 0.14
183 0.17
184 0.18
185 0.2
186 0.21
187 0.21
188 0.23
189 0.28
190 0.28
191 0.35
192 0.44
193 0.52
194 0.56
195 0.6
196 0.59
197 0.57
198 0.62
199 0.61
200 0.52
201 0.51
202 0.48
203 0.46
204 0.48
205 0.46
206 0.37
207 0.3
208 0.29
209 0.24
210 0.22
211 0.2
212 0.17
213 0.16
214 0.16
215 0.13
216 0.14
217 0.13
218 0.12
219 0.11
220 0.12
221 0.13
222 0.14
223 0.18
224 0.17
225 0.19
226 0.23
227 0.23
228 0.21
229 0.21
230 0.2
231 0.15
232 0.14
233 0.11
234 0.07
235 0.07
236 0.07
237 0.06
238 0.04
239 0.05
240 0.1
241 0.16
242 0.22
243 0.32
244 0.41
245 0.49
246 0.58
247 0.66
248 0.71
249 0.77
250 0.82
251 0.82
252 0.83
253 0.85
254 0.82