Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3N1U4

Protein Details
Accession A0A5M3N1U4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-26SRQGGKLKPLKAPKKDKKEDDEDEKBasic
NLS Segment(s)
PositionSequence
6-43GKLKPLKAPKKDKKEDDEDEKAFKERKKAEEAALKAAK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
KEGG cput:CONPUDRAFT_162568  -  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MSRQGGKLKPLKAPKKDKKEDDEDEKAFKERKKAEEAALKAAKDKALKGECSLLSLPSRLTLCRWCTWGWNQEIRQEISHVDMVPCYTSGICARRYHPDARLPCGLGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.87
4 0.87
5 0.85
6 0.84
7 0.82
8 0.79
9 0.77
10 0.68
11 0.62
12 0.55
13 0.51
14 0.46
15 0.4
16 0.4
17 0.38
18 0.4
19 0.44
20 0.45
21 0.47
22 0.5
23 0.5
24 0.5
25 0.47
26 0.42
27 0.36
28 0.35
29 0.31
30 0.24
31 0.23
32 0.21
33 0.22
34 0.22
35 0.22
36 0.25
37 0.22
38 0.23
39 0.23
40 0.17
41 0.14
42 0.14
43 0.13
44 0.11
45 0.12
46 0.09
47 0.11
48 0.15
49 0.18
50 0.19
51 0.21
52 0.2
53 0.24
54 0.28
55 0.33
56 0.33
57 0.37
58 0.37
59 0.38
60 0.42
61 0.4
62 0.35
63 0.3
64 0.25
65 0.21
66 0.21
67 0.18
68 0.14
69 0.13
70 0.13
71 0.12
72 0.12
73 0.1
74 0.08
75 0.09
76 0.14
77 0.18
78 0.22
79 0.25
80 0.27
81 0.36
82 0.41
83 0.44
84 0.45
85 0.51
86 0.51
87 0.54
88 0.56