Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M3MJ62

Protein Details
Accession A0A5M3MJ62    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
58-83QAYRDCKKTWLEKKRTDRRSGRDVPIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.333, cyto 4.5, cyto_mito 3.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
KEGG cput:CONPUDRAFT_60192  -  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSSKELPLPVDNVQPEDYHKKFSVSLTSSFPCEGAAKASMKCMDKNNYDRDKCLDFFQAYRDCKKTWLEKKRTDRRSGRDVPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.32
4 0.31
5 0.31
6 0.3
7 0.3
8 0.3
9 0.31
10 0.34
11 0.28
12 0.3
13 0.29
14 0.29
15 0.29
16 0.27
17 0.25
18 0.18
19 0.16
20 0.13
21 0.1
22 0.12
23 0.12
24 0.12
25 0.14
26 0.17
27 0.17
28 0.19
29 0.22
30 0.24
31 0.28
32 0.33
33 0.41
34 0.46
35 0.46
36 0.45
37 0.45
38 0.44
39 0.39
40 0.36
41 0.32
42 0.24
43 0.24
44 0.28
45 0.32
46 0.32
47 0.36
48 0.37
49 0.33
50 0.36
51 0.41
52 0.46
53 0.48
54 0.56
55 0.61
56 0.68
57 0.78
58 0.85
59 0.88
60 0.88
61 0.87
62 0.84
63 0.84