Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MBS5

Protein Details
Accession A0A5M3MBS5   
Localization Confidence High
Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-37LQGGAKAKKARSKRQKKTSSTPSTSTHydrophilic
NLS Segment(s)
PositionSequence
6-29DKLKKELQGGAKAKKARSKRQKKT
45-82PARAARAKYSATKAKKPKANKPSGGNGGRKAGKQPASK
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
KEGG cput:CONPUDRAFT_158551  -  
Amino Acid Sequences MDKKLDKLKKELQGGAKAKKARSKRQKKTSSTPSTSTATPTVPPPARAARAKYSATKAKKPKANKPSGGNGGRKAGKQPASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.64
3 0.62
4 0.58
5 0.55
6 0.57
7 0.58
8 0.59
9 0.64
10 0.7
11 0.74
12 0.81
13 0.87
14 0.87
15 0.88
16 0.88
17 0.87
18 0.8
19 0.73
20 0.65
21 0.58
22 0.5
23 0.42
24 0.33
25 0.23
26 0.19
27 0.17
28 0.19
29 0.17
30 0.18
31 0.19
32 0.21
33 0.24
34 0.26
35 0.3
36 0.28
37 0.33
38 0.34
39 0.35
40 0.38
41 0.43
42 0.46
43 0.51
44 0.55
45 0.58
46 0.63
47 0.68
48 0.72
49 0.74
50 0.79
51 0.77
52 0.74
53 0.75
54 0.77
55 0.76
56 0.71
57 0.64
58 0.62
59 0.58
60 0.53
61 0.48
62 0.47