Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3N0W6

Protein Details
Accession A0A5M3N0W6    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
121-147GKNRAEKKVKAPKSPKKEKKKEEVEAPBasic
231-252AEEKKEKEKKAKVSRRLSARVSBasic
NLS Segment(s)
PositionSequence
98-142GAKKEDRPKSPGILAKLLAPFKDGKNRAEKKVKAPKSPKKEKKKE
229-250KAAEEKKEKEKKAKVSRRLSAR
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 6, cyto 5.5
Family & Domain DBs
KEGG cput:CONPUDRAFT_79730  -  
Amino Acid Sequences MSATEAPAATAVPAEEVKATEAPAPAAEETPIPAEEPKAEEAAPAPAEAPKEEEATPEEAAPAAESEAAPAEPVKEETKEEAKEEAKEEAKAETPAEGAKKEDRPKSPGILAKLLAPFKDGKNRAEKKVKAPKSPKKEKKKEEVEAPAAAPAEEAAKEEPAAEAAAEPKAEEIAAPAAEEPAKVEETPAEPVKETETAAEEPIPAPEQSAAEPAAEATTPAAEAPKEDKAAEEKKEKEKKAKVSRRLSARVSDLFKSRPKHEVSTPAKVDEHPPKIDEPAPVGPLEDPASEEAPAAAPIAEEVSPAEEAETPAEPAPAAAPVVAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.12
5 0.13
6 0.14
7 0.15
8 0.15
9 0.15
10 0.15
11 0.17
12 0.15
13 0.15
14 0.15
15 0.12
16 0.13
17 0.14
18 0.13
19 0.12
20 0.12
21 0.13
22 0.14
23 0.17
24 0.17
25 0.16
26 0.16
27 0.15
28 0.16
29 0.19
30 0.17
31 0.14
32 0.13
33 0.13
34 0.15
35 0.14
36 0.17
37 0.15
38 0.17
39 0.17
40 0.18
41 0.19
42 0.21
43 0.21
44 0.17
45 0.16
46 0.13
47 0.13
48 0.12
49 0.09
50 0.06
51 0.07
52 0.06
53 0.06
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.07
60 0.1
61 0.12
62 0.12
63 0.14
64 0.18
65 0.24
66 0.25
67 0.26
68 0.28
69 0.28
70 0.29
71 0.29
72 0.3
73 0.26
74 0.25
75 0.24
76 0.21
77 0.21
78 0.2
79 0.18
80 0.13
81 0.12
82 0.13
83 0.14
84 0.13
85 0.14
86 0.18
87 0.25
88 0.31
89 0.38
90 0.4
91 0.43
92 0.46
93 0.47
94 0.48
95 0.45
96 0.41
97 0.37
98 0.34
99 0.32
100 0.33
101 0.3
102 0.24
103 0.21
104 0.2
105 0.19
106 0.28
107 0.27
108 0.27
109 0.37
110 0.42
111 0.49
112 0.56
113 0.57
114 0.58
115 0.66
116 0.69
117 0.68
118 0.74
119 0.75
120 0.77
121 0.84
122 0.84
123 0.85
124 0.89
125 0.87
126 0.87
127 0.87
128 0.82
129 0.78
130 0.75
131 0.67
132 0.58
133 0.49
134 0.4
135 0.3
136 0.25
137 0.16
138 0.09
139 0.07
140 0.05
141 0.06
142 0.05
143 0.05
144 0.05
145 0.06
146 0.05
147 0.05
148 0.05
149 0.04
150 0.04
151 0.05
152 0.05
153 0.05
154 0.05
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.06
169 0.07
170 0.06
171 0.07
172 0.07
173 0.09
174 0.12
175 0.13
176 0.12
177 0.12
178 0.12
179 0.14
180 0.14
181 0.13
182 0.1
183 0.11
184 0.11
185 0.12
186 0.12
187 0.1
188 0.09
189 0.1
190 0.11
191 0.08
192 0.08
193 0.08
194 0.08
195 0.08
196 0.1
197 0.09
198 0.08
199 0.08
200 0.08
201 0.07
202 0.06
203 0.06
204 0.04
205 0.04
206 0.04
207 0.04
208 0.05
209 0.04
210 0.06
211 0.09
212 0.12
213 0.13
214 0.13
215 0.14
216 0.2
217 0.26
218 0.3
219 0.34
220 0.37
221 0.46
222 0.55
223 0.59
224 0.62
225 0.65
226 0.7
227 0.74
228 0.79
229 0.79
230 0.79
231 0.82
232 0.81
233 0.8
234 0.73
235 0.66
236 0.61
237 0.57
238 0.51
239 0.47
240 0.42
241 0.4
242 0.43
243 0.43
244 0.41
245 0.42
246 0.43
247 0.45
248 0.46
249 0.52
250 0.52
251 0.57
252 0.56
253 0.52
254 0.49
255 0.45
256 0.47
257 0.46
258 0.45
259 0.38
260 0.37
261 0.36
262 0.39
263 0.41
264 0.35
265 0.31
266 0.28
267 0.28
268 0.26
269 0.25
270 0.21
271 0.21
272 0.21
273 0.15
274 0.13
275 0.14
276 0.15
277 0.14
278 0.14
279 0.12
280 0.11
281 0.11
282 0.1
283 0.07
284 0.06
285 0.06
286 0.08
287 0.07
288 0.07
289 0.07
290 0.09
291 0.09
292 0.09
293 0.1
294 0.09
295 0.1
296 0.13
297 0.13
298 0.13
299 0.13
300 0.14
301 0.12
302 0.11
303 0.11
304 0.1
305 0.09
306 0.08
307 0.07