Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M3MU35

Protein Details
Accession A0A5M3MU35    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MAKSKNHTNHNQNRKAHRNGIKKPKSNRTRSLKHydrophilic
NLS Segment(s)
PositionSequence
14-43RKAHRNGIKKPKSNRTRSLKGVDPKFRRNS
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cput:CONPUDRAFT_153099  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNRKAHRNGIKKPKSNRTRSLKGVDPKFRRNSLHALVGSRKAREEQKASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.79
4 0.78
5 0.77
6 0.78
7 0.81
8 0.81
9 0.8
10 0.82
11 0.83
12 0.83
13 0.81
14 0.8
15 0.78
16 0.75
17 0.72
18 0.68
19 0.65
20 0.63
21 0.63
22 0.63
23 0.6
24 0.62
25 0.62
26 0.62
27 0.58
28 0.54
29 0.53
30 0.47
31 0.49
32 0.42
33 0.4
34 0.4
35 0.44
36 0.44
37 0.38
38 0.36
39 0.33
40 0.38
41 0.42