Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M3N1R1

Protein Details
Accession A0A5M3N1R1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
28-57WYELRRTARHEKKGYKRRRLESERWRKQFABasic
NLS Segment(s)
PositionSequence
32-74RRTARHEKKGYKRRRLESERWRKQFAHEVRKKVKLVDTIRRRG
Subcellular Location(s) mito 20.5, cyto_mito 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cput:CONPUDRAFT_49419  -  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences GRRVTVPRGDLGLAFNRLNQRLRRNRVWYELRRTARHEKKGYKRRRLESERWRKQFAHEVRKKVKLVDTIRRRGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.25
4 0.28
5 0.33
6 0.36
7 0.41
8 0.48
9 0.55
10 0.61
11 0.63
12 0.64
13 0.67
14 0.71
15 0.68
16 0.67
17 0.69
18 0.65
19 0.61
20 0.63
21 0.65
22 0.64
23 0.65
24 0.63
25 0.63
26 0.69
27 0.76
28 0.81
29 0.8
30 0.81
31 0.79
32 0.83
33 0.82
34 0.81
35 0.83
36 0.84
37 0.84
38 0.8
39 0.78
40 0.68
41 0.64
42 0.64
43 0.63
44 0.63
45 0.59
46 0.64
47 0.67
48 0.74
49 0.7
50 0.64
51 0.61
52 0.59
53 0.6
54 0.61
55 0.64