Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3N7I6

Protein Details
Accession A0A5M3N7I6   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
209-232EQESERRSKIKAKKKQEVSEMATSHydrophilic
NLS Segment(s)
PositionSequence
213-223ERRSKIKAKKK
Subcellular Location(s) mito 11, nucl 9, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR021036  Ribosomal_S35_mit  
KEGG cput:CONPUDRAFT_46275  -  
Pfam View protein in Pfam  
PF12298  Bot1p  
Amino Acid Sequences MQPFPNNRSFKPPTPVSDEVKTEIWRAFMADPQTNSVRNLASRYHLSIKRVDAILRLKGVEEHFKKGQELQTGFLRGMEHILGVHRPGTQPIRNRPNEASERHDVDEADAQDEMAGSDAARQRYQRMFWEPVPEGKEPVMPGILEAASQEAAARKKAQEAAKSNPRLTPEYHSKVNERVKMVHAAGRPPVKFVDVGGKFLDLKSIARREQESERRSKIKAKKKQEVSEMATSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.59
4 0.57
5 0.53
6 0.48
7 0.46
8 0.42
9 0.36
10 0.32
11 0.27
12 0.22
13 0.21
14 0.19
15 0.19
16 0.23
17 0.25
18 0.25
19 0.28
20 0.31
21 0.3
22 0.3
23 0.28
24 0.25
25 0.22
26 0.23
27 0.21
28 0.22
29 0.24
30 0.27
31 0.34
32 0.35
33 0.36
34 0.38
35 0.39
36 0.39
37 0.37
38 0.33
39 0.3
40 0.31
41 0.32
42 0.28
43 0.26
44 0.22
45 0.23
46 0.25
47 0.29
48 0.27
49 0.3
50 0.31
51 0.32
52 0.33
53 0.34
54 0.36
55 0.33
56 0.32
57 0.29
58 0.31
59 0.31
60 0.3
61 0.27
62 0.23
63 0.15
64 0.15
65 0.12
66 0.08
67 0.07
68 0.08
69 0.07
70 0.07
71 0.08
72 0.08
73 0.08
74 0.12
75 0.17
76 0.21
77 0.27
78 0.36
79 0.45
80 0.47
81 0.5
82 0.48
83 0.5
84 0.51
85 0.47
86 0.43
87 0.37
88 0.38
89 0.35
90 0.35
91 0.27
92 0.23
93 0.24
94 0.18
95 0.15
96 0.11
97 0.1
98 0.09
99 0.09
100 0.08
101 0.04
102 0.04
103 0.03
104 0.06
105 0.09
106 0.11
107 0.12
108 0.12
109 0.16
110 0.18
111 0.2
112 0.21
113 0.24
114 0.27
115 0.28
116 0.34
117 0.31
118 0.33
119 0.35
120 0.3
121 0.26
122 0.22
123 0.22
124 0.16
125 0.15
126 0.12
127 0.08
128 0.08
129 0.08
130 0.07
131 0.06
132 0.06
133 0.06
134 0.05
135 0.05
136 0.06
137 0.08
138 0.09
139 0.11
140 0.13
141 0.12
142 0.16
143 0.22
144 0.26
145 0.31
146 0.35
147 0.42
148 0.5
149 0.54
150 0.52
151 0.48
152 0.48
153 0.42
154 0.39
155 0.38
156 0.38
157 0.39
158 0.43
159 0.43
160 0.43
161 0.49
162 0.54
163 0.52
164 0.45
165 0.42
166 0.4
167 0.43
168 0.41
169 0.38
170 0.32
171 0.3
172 0.33
173 0.37
174 0.34
175 0.31
176 0.3
177 0.26
178 0.24
179 0.22
180 0.27
181 0.21
182 0.24
183 0.22
184 0.23
185 0.22
186 0.22
187 0.24
188 0.14
189 0.16
190 0.22
191 0.27
192 0.29
193 0.33
194 0.36
195 0.37
196 0.47
197 0.54
198 0.54
199 0.57
200 0.61
201 0.62
202 0.63
203 0.68
204 0.67
205 0.68
206 0.71
207 0.73
208 0.76
209 0.81
210 0.87
211 0.86
212 0.85
213 0.81