Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M3MVB0

Protein Details
Accession A0A5M3MVB0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
26-50GSEYQPSQRKRKRKHGFLARKRTASHydrophilic
NLS Segment(s)
PositionSequence
33-63QRKRKRKHGFLARKRTASGRRILMRRRAKGR
Subcellular Location(s) mito 15, nucl 9, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cput:CONPUDRAFT_19255  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences PPTILPLAASSPILHAVFQKRYASRGSEYQPSQRKRKRKHGFLARKRTASGRRILMRRRAKGRSTLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.2
4 0.23
5 0.26
6 0.3
7 0.27
8 0.29
9 0.31
10 0.3
11 0.27
12 0.3
13 0.29
14 0.31
15 0.33
16 0.39
17 0.45
18 0.47
19 0.55
20 0.56
21 0.63
22 0.65
23 0.74
24 0.76
25 0.77
26 0.82
27 0.83
28 0.88
29 0.88
30 0.91
31 0.86
32 0.78
33 0.7
34 0.67
35 0.64
36 0.58
37 0.54
38 0.51
39 0.53
40 0.58
41 0.64
42 0.67
43 0.69
44 0.73
45 0.75
46 0.74
47 0.71
48 0.73