Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M3MJA4

Protein Details
Accession A0A5M3MJA4    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPRPRPKPKPKAKPMSDTTSQHydrophilic
NLS Segment(s)
PositionSequence
3-13RPRPKPKPKAK
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 10
Family & Domain DBs
KEGG cput:CONPUDRAFT_155811  -  
Amino Acid Sequences MPRPRPKPKPKAKPMSDTTSQPAFDAAPNLTELTPAPVAKPMSNPISDTAPKSANAHLLKAAEPTLKPIEPTPSSIPTPEHRYSVCNTTPEPVFESIPSATKPMSKATPTLPAKSPRSDSPSINSMVSQHSNKTNSTSAKRLTKATNPKTGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.83
3 0.76
4 0.69
5 0.64
6 0.57
7 0.5
8 0.4
9 0.34
10 0.26
11 0.23
12 0.21
13 0.16
14 0.12
15 0.12
16 0.13
17 0.12
18 0.12
19 0.11
20 0.12
21 0.14
22 0.13
23 0.12
24 0.16
25 0.17
26 0.18
27 0.2
28 0.2
29 0.21
30 0.22
31 0.22
32 0.2
33 0.24
34 0.24
35 0.24
36 0.23
37 0.21
38 0.21
39 0.22
40 0.21
41 0.24
42 0.23
43 0.22
44 0.2
45 0.2
46 0.19
47 0.18
48 0.19
49 0.12
50 0.12
51 0.14
52 0.15
53 0.14
54 0.15
55 0.15
56 0.19
57 0.18
58 0.22
59 0.21
60 0.21
61 0.22
62 0.22
63 0.23
64 0.21
65 0.28
66 0.25
67 0.24
68 0.21
69 0.23
70 0.24
71 0.28
72 0.27
73 0.21
74 0.2
75 0.21
76 0.21
77 0.2
78 0.21
79 0.17
80 0.15
81 0.13
82 0.15
83 0.13
84 0.14
85 0.14
86 0.12
87 0.11
88 0.13
89 0.14
90 0.15
91 0.18
92 0.18
93 0.2
94 0.21
95 0.31
96 0.31
97 0.34
98 0.36
99 0.4
100 0.43
101 0.46
102 0.47
103 0.43
104 0.47
105 0.47
106 0.43
107 0.41
108 0.41
109 0.39
110 0.35
111 0.3
112 0.24
113 0.26
114 0.29
115 0.25
116 0.25
117 0.29
118 0.31
119 0.32
120 0.35
121 0.37
122 0.39
123 0.43
124 0.46
125 0.47
126 0.54
127 0.55
128 0.56
129 0.56
130 0.59
131 0.64
132 0.65