Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MK51

Protein Details
Accession A0A5M3MK51    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
141-190PEELRDKKRKVKAEKKDGREKKRARAGALDVKGKKARVGTKKKDAPKVGTBasic
NLS Segment(s)
PositionSequence
145-187RDKKRKVKAEKKDGREKKRARAGALDVKGKKARVGTKKKDAPK
Subcellular Location(s) nucl 10, cyto_nucl 9.833, cyto_mito 8.666, mito 8.5, cyto 7.5
Family & Domain DBs
KEGG cput:CONPUDRAFT_59017  -  
Amino Acid Sequences KLAVRLRKFGALPQDSPWKHDKFLQVLRYQLMSDDEDGWDAEKGKKTNHFVSRAPVYRSKLLNDFLAAVDTIPDPNGKPSYVLRVRGEPKEQEVPVITDISSRTRRWMVDMEWLSQPENKKWDVESRITGNGKVWGDDDDPEELRDKKRKVKAEKKDGREKKRARAGALDVKGKKARVGTKKKDAPKVGTSKSAAAIDVASSDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.45
3 0.48
4 0.51
5 0.43
6 0.4
7 0.43
8 0.45
9 0.43
10 0.51
11 0.54
12 0.5
13 0.5
14 0.5
15 0.45
16 0.38
17 0.31
18 0.26
19 0.2
20 0.18
21 0.17
22 0.15
23 0.14
24 0.14
25 0.14
26 0.12
27 0.12
28 0.15
29 0.19
30 0.2
31 0.24
32 0.31
33 0.36
34 0.44
35 0.49
36 0.5
37 0.47
38 0.52
39 0.56
40 0.54
41 0.53
42 0.5
43 0.47
44 0.47
45 0.48
46 0.44
47 0.39
48 0.37
49 0.33
50 0.27
51 0.24
52 0.18
53 0.17
54 0.13
55 0.09
56 0.08
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.09
63 0.11
64 0.1
65 0.11
66 0.12
67 0.21
68 0.24
69 0.29
70 0.27
71 0.33
72 0.37
73 0.38
74 0.41
75 0.33
76 0.33
77 0.33
78 0.32
79 0.26
80 0.23
81 0.21
82 0.18
83 0.17
84 0.13
85 0.09
86 0.1
87 0.14
88 0.17
89 0.15
90 0.17
91 0.19
92 0.19
93 0.21
94 0.23
95 0.19
96 0.25
97 0.26
98 0.26
99 0.25
100 0.25
101 0.23
102 0.23
103 0.23
104 0.17
105 0.19
106 0.17
107 0.17
108 0.18
109 0.24
110 0.26
111 0.27
112 0.28
113 0.28
114 0.33
115 0.33
116 0.32
117 0.26
118 0.27
119 0.24
120 0.21
121 0.19
122 0.15
123 0.15
124 0.16
125 0.16
126 0.14
127 0.14
128 0.14
129 0.16
130 0.16
131 0.21
132 0.28
133 0.31
134 0.38
135 0.45
136 0.54
137 0.62
138 0.71
139 0.76
140 0.8
141 0.85
142 0.85
143 0.88
144 0.89
145 0.87
146 0.87
147 0.83
148 0.81
149 0.82
150 0.77
151 0.69
152 0.66
153 0.64
154 0.63
155 0.61
156 0.6
157 0.51
158 0.53
159 0.53
160 0.47
161 0.42
162 0.39
163 0.43
164 0.46
165 0.55
166 0.59
167 0.66
168 0.75
169 0.81
170 0.84
171 0.81
172 0.77
173 0.76
174 0.76
175 0.69
176 0.68
177 0.62
178 0.54
179 0.51
180 0.45
181 0.35
182 0.27
183 0.23
184 0.16
185 0.14