Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MSU7

Protein Details
Accession A0A5M3MSU7   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-24VSEVTNGRKKRKQADAEPEVVKHydrophilic
NLS Segment(s)
PositionSequence
250-281PKRRWLASKWEKKKIMKIVRAIRLGRIVPSKP
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR028598  BOP1/Erb1  
IPR012953  BOP1_N_dom  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR036322  WD40_repeat_dom_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0030687  C:preribosome, large subunit precursor  
GO:0043021  F:ribonucleoprotein complex binding  
GO:0000466  P:maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG cput:CONPUDRAFT_122945  -  
Pfam View protein in Pfam  
PF08145  BOP1NT  
PF00400  WD40  
PROSITE View protein in PROSITE  
PS50082  WD_REPEATS_2  
Amino Acid Sequences MAVSEVTNGRKKRKQADAEPEVVKSTFPETVGLELPSDEEEGEDESDDGEVEEFPEIDARSDSEDDAEDGSDDEEEDEDEEDDEDEEDEEEDDSVSDSTSDAGVFPKPKTIVSDITGQPKRVYPDIEPDYDSDSSTEDDPNRIGNVPLHWYDDMPHIGYNINGRRVLRPALGDELDKFLSTVEDPQAWQSAFDKNAQMDKPLTGEELDLIRRLQAGENPDGDYNPYEPTVEWFTGKGKEEVMPLSAAPEPKRRWLASKWEKKKIMKIVRAIRLGRIVPSKPKATDGKHFYDIWTEAPSEHAPPLPAPKPSLPTHSESYNPPAEYLPAEEERKKWQEAEPEDREQDYLPQKYSALRLVPAYDRFIKERFNRQLDLYLAPRIQRKKLNIDPESLIPKLPSPSSLKPFPNYKSLKVAHTEGRTRCVSVSPDGSWVVSGDEGGNLILWEVIVGRAVKRWKLDGKIGTVEWCPRTDVAFFVVGTEEKLQFFVPPNLPRAVLSLTQSILAPATLPPPTPSSIKWTSSFSSGENEALLTIELSSGSGLPKQFAWHRKGDYLASVSTNESQGGVWVHQLSRRHSQAPFKKIKGTVQLVQFHPSKPHFFVATQRYVRLYNLAEQKLLKTLMPGIRWISSMDVHPSGDHVIVGGYDRKLCWFDLELSDKPYKILRYHTRAIRSLQFHPTYPLFASSSDDGSIQIFHARVYNDLMTDPLIVPLKILRGHEVKDGLGVLQVKWVPRQPWLVSAGADGSAMVWCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.82
4 0.8
5 0.81
6 0.75
7 0.67
8 0.59
9 0.49
10 0.38
11 0.29
12 0.24
13 0.19
14 0.17
15 0.18
16 0.16
17 0.19
18 0.21
19 0.2
20 0.17
21 0.15
22 0.16
23 0.14
24 0.14
25 0.1
26 0.09
27 0.09
28 0.1
29 0.11
30 0.1
31 0.09
32 0.09
33 0.09
34 0.09
35 0.08
36 0.07
37 0.06
38 0.06
39 0.07
40 0.07
41 0.07
42 0.1
43 0.1
44 0.11
45 0.12
46 0.12
47 0.15
48 0.17
49 0.17
50 0.15
51 0.15
52 0.15
53 0.15
54 0.14
55 0.1
56 0.1
57 0.1
58 0.08
59 0.08
60 0.07
61 0.07
62 0.07
63 0.07
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.08
72 0.08
73 0.08
74 0.08
75 0.08
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.07
90 0.12
91 0.15
92 0.15
93 0.21
94 0.21
95 0.22
96 0.27
97 0.29
98 0.3
99 0.29
100 0.37
101 0.34
102 0.44
103 0.46
104 0.43
105 0.4
106 0.39
107 0.41
108 0.36
109 0.36
110 0.28
111 0.35
112 0.39
113 0.39
114 0.37
115 0.34
116 0.35
117 0.32
118 0.3
119 0.2
120 0.17
121 0.16
122 0.16
123 0.19
124 0.15
125 0.16
126 0.17
127 0.18
128 0.18
129 0.17
130 0.17
131 0.16
132 0.17
133 0.2
134 0.21
135 0.23
136 0.21
137 0.21
138 0.21
139 0.23
140 0.23
141 0.19
142 0.18
143 0.15
144 0.15
145 0.16
146 0.22
147 0.22
148 0.24
149 0.26
150 0.27
151 0.29
152 0.32
153 0.34
154 0.29
155 0.26
156 0.24
157 0.26
158 0.26
159 0.25
160 0.22
161 0.23
162 0.21
163 0.19
164 0.16
165 0.11
166 0.11
167 0.11
168 0.13
169 0.11
170 0.12
171 0.13
172 0.14
173 0.17
174 0.16
175 0.17
176 0.15
177 0.18
178 0.18
179 0.2
180 0.21
181 0.19
182 0.25
183 0.25
184 0.26
185 0.23
186 0.22
187 0.21
188 0.19
189 0.18
190 0.12
191 0.12
192 0.11
193 0.12
194 0.12
195 0.12
196 0.11
197 0.11
198 0.11
199 0.11
200 0.11
201 0.12
202 0.16
203 0.18
204 0.19
205 0.21
206 0.21
207 0.2
208 0.2
209 0.18
210 0.14
211 0.12
212 0.11
213 0.1
214 0.1
215 0.13
216 0.16
217 0.15
218 0.15
219 0.15
220 0.17
221 0.21
222 0.22
223 0.2
224 0.17
225 0.18
226 0.19
227 0.19
228 0.18
229 0.14
230 0.12
231 0.13
232 0.14
233 0.15
234 0.16
235 0.23
236 0.23
237 0.29
238 0.34
239 0.33
240 0.36
241 0.39
242 0.48
243 0.51
244 0.6
245 0.63
246 0.67
247 0.73
248 0.72
249 0.75
250 0.74
251 0.73
252 0.68
253 0.69
254 0.68
255 0.68
256 0.7
257 0.63
258 0.55
259 0.49
260 0.43
261 0.38
262 0.33
263 0.28
264 0.29
265 0.32
266 0.34
267 0.3
268 0.35
269 0.38
270 0.37
271 0.44
272 0.43
273 0.44
274 0.44
275 0.44
276 0.39
277 0.36
278 0.33
279 0.25
280 0.21
281 0.15
282 0.12
283 0.14
284 0.15
285 0.13
286 0.12
287 0.12
288 0.11
289 0.11
290 0.17
291 0.17
292 0.18
293 0.19
294 0.2
295 0.24
296 0.25
297 0.3
298 0.27
299 0.29
300 0.3
301 0.29
302 0.29
303 0.26
304 0.3
305 0.28
306 0.25
307 0.21
308 0.19
309 0.18
310 0.17
311 0.16
312 0.14
313 0.14
314 0.16
315 0.17
316 0.18
317 0.24
318 0.27
319 0.26
320 0.25
321 0.24
322 0.3
323 0.34
324 0.42
325 0.41
326 0.4
327 0.41
328 0.39
329 0.37
330 0.28
331 0.28
332 0.25
333 0.22
334 0.2
335 0.19
336 0.19
337 0.2
338 0.22
339 0.19
340 0.14
341 0.13
342 0.13
343 0.14
344 0.16
345 0.16
346 0.18
347 0.18
348 0.18
349 0.19
350 0.2
351 0.24
352 0.26
353 0.35
354 0.39
355 0.4
356 0.4
357 0.39
358 0.41
359 0.36
360 0.35
361 0.26
362 0.21
363 0.18
364 0.19
365 0.23
366 0.22
367 0.25
368 0.27
369 0.29
370 0.36
371 0.41
372 0.48
373 0.45
374 0.46
375 0.43
376 0.41
377 0.4
378 0.32
379 0.26
380 0.17
381 0.16
382 0.15
383 0.13
384 0.14
385 0.16
386 0.2
387 0.25
388 0.31
389 0.31
390 0.33
391 0.39
392 0.38
393 0.42
394 0.4
395 0.37
396 0.39
397 0.39
398 0.38
399 0.36
400 0.36
401 0.32
402 0.34
403 0.38
404 0.32
405 0.35
406 0.33
407 0.3
408 0.28
409 0.25
410 0.22
411 0.18
412 0.2
413 0.16
414 0.17
415 0.17
416 0.17
417 0.14
418 0.12
419 0.1
420 0.07
421 0.06
422 0.05
423 0.04
424 0.04
425 0.04
426 0.04
427 0.03
428 0.03
429 0.03
430 0.03
431 0.03
432 0.03
433 0.03
434 0.04
435 0.05
436 0.05
437 0.09
438 0.11
439 0.14
440 0.15
441 0.19
442 0.23
443 0.26
444 0.32
445 0.32
446 0.33
447 0.34
448 0.33
449 0.31
450 0.28
451 0.28
452 0.23
453 0.2
454 0.18
455 0.15
456 0.16
457 0.15
458 0.14
459 0.12
460 0.12
461 0.11
462 0.11
463 0.11
464 0.1
465 0.1
466 0.11
467 0.1
468 0.09
469 0.1
470 0.09
471 0.1
472 0.13
473 0.17
474 0.21
475 0.22
476 0.25
477 0.26
478 0.26
479 0.25
480 0.24
481 0.22
482 0.18
483 0.17
484 0.16
485 0.15
486 0.15
487 0.15
488 0.13
489 0.1
490 0.08
491 0.07
492 0.05
493 0.07
494 0.08
495 0.08
496 0.09
497 0.12
498 0.14
499 0.15
500 0.16
501 0.21
502 0.25
503 0.28
504 0.29
505 0.3
506 0.29
507 0.31
508 0.31
509 0.24
510 0.23
511 0.21
512 0.19
513 0.16
514 0.14
515 0.11
516 0.1
517 0.09
518 0.05
519 0.04
520 0.04
521 0.04
522 0.04
523 0.04
524 0.04
525 0.05
526 0.07
527 0.08
528 0.08
529 0.09
530 0.13
531 0.19
532 0.26
533 0.31
534 0.35
535 0.37
536 0.39
537 0.41
538 0.39
539 0.35
540 0.31
541 0.27
542 0.22
543 0.2
544 0.19
545 0.18
546 0.18
547 0.14
548 0.12
549 0.1
550 0.11
551 0.11
552 0.1
553 0.1
554 0.11
555 0.12
556 0.15
557 0.2
558 0.23
559 0.3
560 0.34
561 0.36
562 0.38
563 0.48
564 0.53
565 0.59
566 0.63
567 0.58
568 0.61
569 0.6
570 0.62
571 0.6
572 0.57
573 0.53
574 0.51
575 0.55
576 0.49
577 0.51
578 0.48
579 0.4
580 0.41
581 0.39
582 0.36
583 0.32
584 0.34
585 0.31
586 0.3
587 0.37
588 0.38
589 0.45
590 0.42
591 0.41
592 0.4
593 0.39
594 0.38
595 0.34
596 0.28
597 0.26
598 0.33
599 0.33
600 0.32
601 0.32
602 0.32
603 0.32
604 0.31
605 0.24
606 0.16
607 0.22
608 0.24
609 0.25
610 0.26
611 0.25
612 0.25
613 0.25
614 0.25
615 0.2
616 0.17
617 0.18
618 0.2
619 0.2
620 0.19
621 0.18
622 0.19
623 0.18
624 0.17
625 0.14
626 0.09
627 0.08
628 0.08
629 0.1
630 0.12
631 0.12
632 0.13
633 0.13
634 0.16
635 0.17
636 0.18
637 0.19
638 0.18
639 0.2
640 0.26
641 0.32
642 0.31
643 0.35
644 0.37
645 0.34
646 0.33
647 0.33
648 0.31
649 0.28
650 0.37
651 0.41
652 0.47
653 0.55
654 0.61
655 0.63
656 0.63
657 0.65
658 0.64
659 0.59
660 0.56
661 0.57
662 0.53
663 0.47
664 0.48
665 0.44
666 0.39
667 0.35
668 0.33
669 0.24
670 0.22
671 0.25
672 0.22
673 0.22
674 0.19
675 0.18
676 0.16
677 0.15
678 0.15
679 0.12
680 0.13
681 0.11
682 0.11
683 0.15
684 0.15
685 0.16
686 0.2
687 0.21
688 0.18
689 0.18
690 0.19
691 0.16
692 0.17
693 0.16
694 0.15
695 0.16
696 0.15
697 0.15
698 0.16
699 0.2
700 0.21
701 0.22
702 0.25
703 0.27
704 0.3
705 0.35
706 0.35
707 0.31
708 0.29
709 0.28
710 0.22
711 0.22
712 0.21
713 0.15
714 0.19
715 0.21
716 0.21
717 0.25
718 0.31
719 0.29
720 0.33
721 0.4
722 0.37
723 0.4
724 0.42
725 0.4
726 0.34
727 0.33
728 0.29
729 0.22
730 0.19
731 0.13
732 0.1