Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MIL8

Protein Details
Accession A0A5M3MIL8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
361-386KVVDEKALRKEQKKAKKKEECNAFADHydrophilic
NLS Segment(s)
PositionSequence
366-378KALRKEQKKAKKK
Subcellular Location(s) mito 18, cyto 6, pero 2
Family & Domain DBs
KEGG cput:CONPUDRAFT_166690  -  
Amino Acid Sequences MGLFSRKKSKPAALPDLYIVDPGYQSQQNTPVKIGFFGLKTPRTPKTPSTPAPPYDSVSYGRGYAAPPIPPIPSVPPTVPLSRQSSAHNNTAPKFIKKRPSLPSIGQPKNGVVRPPCLFPPSDYTAPAQVWAASVQRLAEHAECRIRRVVHCSVRSNATGSQGPSHEFVVVYIRHPCGADAIMVAERGGQDEDAHPQQQDSWDPQRRSSQETLIEERLRIPVTLVRLPPADRVRLAPLGDAGALLSRYAGGVNELHTLSFPKERLAPHVAHVAALLCALNLHNPTTNGGSSQRAAWHAYTFTEVLHTIFGGDGKASKKWVRAPYGGLRVGIEHTVEGAIGSYQRKWEDFMKKLAQPSVKAKVVDEKALRKEQKKAKKKEECNAFADMLRTMENQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.59
3 0.56
4 0.47
5 0.39
6 0.29
7 0.2
8 0.16
9 0.15
10 0.17
11 0.17
12 0.18
13 0.2
14 0.29
15 0.33
16 0.35
17 0.36
18 0.35
19 0.33
20 0.32
21 0.31
22 0.26
23 0.22
24 0.26
25 0.31
26 0.31
27 0.35
28 0.4
29 0.44
30 0.45
31 0.49
32 0.5
33 0.52
34 0.58
35 0.59
36 0.62
37 0.64
38 0.62
39 0.64
40 0.59
41 0.53
42 0.46
43 0.43
44 0.37
45 0.31
46 0.29
47 0.22
48 0.21
49 0.18
50 0.16
51 0.2
52 0.2
53 0.19
54 0.2
55 0.21
56 0.22
57 0.21
58 0.22
59 0.22
60 0.21
61 0.23
62 0.22
63 0.25
64 0.27
65 0.3
66 0.31
67 0.31
68 0.34
69 0.33
70 0.34
71 0.35
72 0.4
73 0.42
74 0.45
75 0.44
76 0.42
77 0.42
78 0.49
79 0.47
80 0.45
81 0.47
82 0.49
83 0.54
84 0.56
85 0.63
86 0.62
87 0.66
88 0.64
89 0.61
90 0.64
91 0.64
92 0.62
93 0.56
94 0.5
95 0.46
96 0.46
97 0.44
98 0.4
99 0.31
100 0.33
101 0.32
102 0.33
103 0.32
104 0.28
105 0.27
106 0.24
107 0.28
108 0.28
109 0.28
110 0.27
111 0.26
112 0.27
113 0.26
114 0.25
115 0.19
116 0.12
117 0.11
118 0.11
119 0.11
120 0.08
121 0.09
122 0.08
123 0.08
124 0.09
125 0.1
126 0.11
127 0.11
128 0.14
129 0.2
130 0.21
131 0.23
132 0.26
133 0.26
134 0.26
135 0.31
136 0.37
137 0.38
138 0.44
139 0.45
140 0.44
141 0.45
142 0.44
143 0.4
144 0.32
145 0.27
146 0.24
147 0.21
148 0.21
149 0.18
150 0.19
151 0.18
152 0.17
153 0.14
154 0.11
155 0.11
156 0.12
157 0.12
158 0.12
159 0.14
160 0.13
161 0.14
162 0.14
163 0.13
164 0.1
165 0.1
166 0.09
167 0.06
168 0.07
169 0.07
170 0.06
171 0.06
172 0.06
173 0.05
174 0.06
175 0.06
176 0.05
177 0.05
178 0.06
179 0.09
180 0.1
181 0.11
182 0.1
183 0.1
184 0.11
185 0.11
186 0.12
187 0.14
188 0.22
189 0.29
190 0.3
191 0.32
192 0.38
193 0.39
194 0.43
195 0.4
196 0.35
197 0.34
198 0.36
199 0.38
200 0.36
201 0.35
202 0.29
203 0.28
204 0.25
205 0.2
206 0.16
207 0.13
208 0.11
209 0.14
210 0.17
211 0.17
212 0.17
213 0.17
214 0.18
215 0.24
216 0.24
217 0.22
218 0.19
219 0.2
220 0.22
221 0.24
222 0.23
223 0.17
224 0.15
225 0.13
226 0.13
227 0.11
228 0.07
229 0.05
230 0.05
231 0.05
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.05
238 0.05
239 0.07
240 0.09
241 0.09
242 0.09
243 0.09
244 0.1
245 0.11
246 0.14
247 0.13
248 0.13
249 0.17
250 0.18
251 0.23
252 0.26
253 0.25
254 0.24
255 0.29
256 0.27
257 0.23
258 0.23
259 0.18
260 0.13
261 0.12
262 0.1
263 0.04
264 0.05
265 0.05
266 0.07
267 0.07
268 0.09
269 0.1
270 0.11
271 0.13
272 0.15
273 0.15
274 0.15
275 0.16
276 0.17
277 0.16
278 0.17
279 0.18
280 0.18
281 0.2
282 0.19
283 0.19
284 0.17
285 0.17
286 0.18
287 0.16
288 0.14
289 0.13
290 0.12
291 0.11
292 0.1
293 0.1
294 0.07
295 0.07
296 0.08
297 0.06
298 0.06
299 0.09
300 0.11
301 0.12
302 0.17
303 0.2
304 0.24
305 0.32
306 0.4
307 0.43
308 0.44
309 0.5
310 0.54
311 0.59
312 0.56
313 0.48
314 0.41
315 0.35
316 0.34
317 0.28
318 0.2
319 0.11
320 0.1
321 0.09
322 0.09
323 0.07
324 0.06
325 0.06
326 0.08
327 0.1
328 0.11
329 0.15
330 0.17
331 0.18
332 0.21
333 0.29
334 0.36
335 0.39
336 0.46
337 0.5
338 0.52
339 0.56
340 0.59
341 0.55
342 0.51
343 0.54
344 0.55
345 0.52
346 0.49
347 0.46
348 0.48
349 0.47
350 0.49
351 0.48
352 0.48
353 0.51
354 0.6
355 0.66
356 0.61
357 0.68
358 0.7
359 0.75
360 0.77
361 0.81
362 0.82
363 0.85
364 0.9
365 0.9
366 0.91
367 0.86
368 0.79
369 0.73
370 0.64
371 0.55
372 0.47
373 0.38
374 0.29
375 0.24