Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3N799

Protein Details
Accession A0A5M3N799   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
119-144LVEAQKEKKNPPQKKVRGKYRAGAADHydrophilic
NLS Segment(s)
PositionSequence
124-139KEKKNPPQKKVRGKYR
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR002672  Ribosomal_L28e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cput:CONPUDRAFT_134534  -  
Pfam View protein in Pfam  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MSSDLQWYLIRNYNSYLVKKVPEGPIFSREPGNLRNLHSYKYSGLANKKAIDISDSGNGIKITTKKTKSSPQAVRGSLTSTTIRNRSGGRRALGAAAQLTKRGYRGDLRAAALGRTSALVEAQKEKKNPPQKKVRGKYRAGAADSSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.37
4 0.33
5 0.34
6 0.35
7 0.38
8 0.39
9 0.37
10 0.4
11 0.39
12 0.41
13 0.42
14 0.41
15 0.37
16 0.31
17 0.31
18 0.28
19 0.3
20 0.28
21 0.28
22 0.36
23 0.35
24 0.36
25 0.34
26 0.33
27 0.29
28 0.28
29 0.28
30 0.24
31 0.28
32 0.31
33 0.32
34 0.31
35 0.31
36 0.29
37 0.26
38 0.22
39 0.18
40 0.15
41 0.14
42 0.14
43 0.13
44 0.14
45 0.13
46 0.12
47 0.13
48 0.13
49 0.16
50 0.23
51 0.26
52 0.28
53 0.32
54 0.4
55 0.45
56 0.52
57 0.54
58 0.54
59 0.58
60 0.55
61 0.52
62 0.44
63 0.39
64 0.3
65 0.25
66 0.18
67 0.14
68 0.16
69 0.17
70 0.18
71 0.18
72 0.2
73 0.23
74 0.28
75 0.31
76 0.29
77 0.29
78 0.29
79 0.28
80 0.25
81 0.21
82 0.16
83 0.14
84 0.13
85 0.13
86 0.13
87 0.12
88 0.13
89 0.13
90 0.15
91 0.17
92 0.2
93 0.26
94 0.28
95 0.29
96 0.31
97 0.31
98 0.28
99 0.24
100 0.2
101 0.14
102 0.1
103 0.09
104 0.06
105 0.08
106 0.09
107 0.11
108 0.18
109 0.25
110 0.3
111 0.33
112 0.38
113 0.46
114 0.55
115 0.62
116 0.65
117 0.69
118 0.74
119 0.83
120 0.88
121 0.9
122 0.89
123 0.86
124 0.83
125 0.82
126 0.79
127 0.71