Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M3MAH2

Protein Details
Accession A0A5M3MAH2    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-28VDDSRTPGKWERRHLPPRRRGGAABasic
NLS Segment(s)
PositionSequence
15-24ERRHLPPRRR
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG cput:CONPUDRAFT_158743  -  
Amino Acid Sequences MRKTVDDSRTPGKWERRHLPPRRRGGAAAVAVPIPNSHDLDATGASPLGHRLSSPIKSVISPESLFVSLPRFLYFLYSPRRSKHVPRRPFYYLGLSNYLGLSVYVELPIYFELSVYIGPSIYLRRPIYVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.67
4 0.75
5 0.81
6 0.83
7 0.83
8 0.86
9 0.82
10 0.77
11 0.67
12 0.61
13 0.58
14 0.49
15 0.4
16 0.31
17 0.25
18 0.22
19 0.21
20 0.16
21 0.1
22 0.1
23 0.1
24 0.1
25 0.1
26 0.1
27 0.11
28 0.12
29 0.1
30 0.08
31 0.07
32 0.07
33 0.07
34 0.08
35 0.07
36 0.07
37 0.06
38 0.09
39 0.13
40 0.15
41 0.17
42 0.17
43 0.17
44 0.17
45 0.19
46 0.17
47 0.16
48 0.15
49 0.13
50 0.13
51 0.12
52 0.12
53 0.11
54 0.12
55 0.1
56 0.1
57 0.1
58 0.09
59 0.08
60 0.11
61 0.12
62 0.15
63 0.22
64 0.28
65 0.3
66 0.31
67 0.37
68 0.37
69 0.47
70 0.53
71 0.56
72 0.6
73 0.62
74 0.68
75 0.68
76 0.68
77 0.6
78 0.57
79 0.51
80 0.44
81 0.43
82 0.35
83 0.31
84 0.27
85 0.24
86 0.16
87 0.12
88 0.09
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.07
95 0.07
96 0.08
97 0.07
98 0.06
99 0.06
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.07
106 0.08
107 0.12
108 0.14
109 0.22
110 0.22