Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M3N7S9

Protein Details
Accession A0A5M3N7S9    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
267-289EMTPRPSRQSDRQKKRHETQSIPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, nucl 6, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
KEGG cput:CONPUDRAFT_149397  -  
Amino Acid Sequences MSTPAPAVQSWALPVGFPWSVIDPTSFSQAQSLFFLLNNRWRLAIDTSCSGDIDVAEWMAGWSWEMAITPMVRKLLAMHGSATVPRHVAAVMCGQNVIPGTPLSVDVSATAPNEKFPICDVTLSYGVGDQWWNRCRRPSPDTSTPPTAMPPMEPLALPASDPTGIDHAKPPAQPQLLSPGGRPATRNAPRSSAAGLVDAAQPSHGDAENAILRPNPAAGPQDTSGVTLCAPSNLGSGLARHTVSVGDDKASAPSGDNDSAVGGDNPEMTPRPSRQSDRQKKRHETQSIPPPDGSVAASKVNDKQAGKRKAMHKSLNVSEPGGSWNPSDDTPLEQLPSIVPTTSARPATGVAADHMDNTLDTLRVSQSLKSSIDALSTNAGTPETFGSALYDYITKGEATTTYSKERLTNWMDAINRHLLTLGERSKEITQVQDGFADRVTNIETTLAKIANRLDALENPSGTYAVPAAPHAADNASLPDGDHQMGDVPRPAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.16
4 0.15
5 0.16
6 0.15
7 0.16
8 0.17
9 0.18
10 0.16
11 0.18
12 0.23
13 0.22
14 0.19
15 0.22
16 0.23
17 0.23
18 0.22
19 0.22
20 0.16
21 0.17
22 0.2
23 0.21
24 0.28
25 0.3
26 0.29
27 0.28
28 0.28
29 0.3
30 0.32
31 0.32
32 0.28
33 0.28
34 0.3
35 0.3
36 0.29
37 0.26
38 0.21
39 0.16
40 0.13
41 0.1
42 0.07
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.08
55 0.09
56 0.11
57 0.13
58 0.14
59 0.14
60 0.14
61 0.15
62 0.2
63 0.22
64 0.22
65 0.2
66 0.21
67 0.22
68 0.24
69 0.24
70 0.18
71 0.15
72 0.14
73 0.14
74 0.12
75 0.11
76 0.11
77 0.17
78 0.17
79 0.17
80 0.17
81 0.16
82 0.17
83 0.17
84 0.16
85 0.09
86 0.07
87 0.08
88 0.08
89 0.09
90 0.09
91 0.09
92 0.09
93 0.09
94 0.1
95 0.11
96 0.11
97 0.13
98 0.12
99 0.12
100 0.14
101 0.13
102 0.13
103 0.13
104 0.18
105 0.15
106 0.16
107 0.16
108 0.19
109 0.2
110 0.19
111 0.17
112 0.13
113 0.12
114 0.12
115 0.13
116 0.11
117 0.17
118 0.23
119 0.27
120 0.29
121 0.36
122 0.41
123 0.47
124 0.52
125 0.54
126 0.56
127 0.63
128 0.68
129 0.67
130 0.67
131 0.6
132 0.53
133 0.46
134 0.39
135 0.29
136 0.22
137 0.18
138 0.15
139 0.14
140 0.14
141 0.13
142 0.13
143 0.13
144 0.12
145 0.09
146 0.09
147 0.08
148 0.09
149 0.08
150 0.1
151 0.11
152 0.12
153 0.14
154 0.16
155 0.18
156 0.19
157 0.2
158 0.24
159 0.25
160 0.24
161 0.22
162 0.27
163 0.28
164 0.28
165 0.26
166 0.25
167 0.26
168 0.26
169 0.26
170 0.22
171 0.28
172 0.34
173 0.39
174 0.35
175 0.37
176 0.37
177 0.38
178 0.36
179 0.28
180 0.22
181 0.17
182 0.15
183 0.13
184 0.13
185 0.11
186 0.1
187 0.07
188 0.07
189 0.06
190 0.08
191 0.07
192 0.05
193 0.05
194 0.08
195 0.1
196 0.11
197 0.11
198 0.09
199 0.1
200 0.1
201 0.1
202 0.08
203 0.07
204 0.09
205 0.09
206 0.12
207 0.13
208 0.14
209 0.14
210 0.14
211 0.13
212 0.11
213 0.1
214 0.08
215 0.07
216 0.06
217 0.06
218 0.06
219 0.06
220 0.06
221 0.06
222 0.05
223 0.06
224 0.07
225 0.08
226 0.08
227 0.07
228 0.08
229 0.07
230 0.08
231 0.1
232 0.08
233 0.07
234 0.08
235 0.08
236 0.09
237 0.09
238 0.08
239 0.07
240 0.08
241 0.1
242 0.09
243 0.09
244 0.09
245 0.08
246 0.08
247 0.08
248 0.07
249 0.05
250 0.04
251 0.05
252 0.05
253 0.06
254 0.06
255 0.07
256 0.1
257 0.12
258 0.17
259 0.21
260 0.26
261 0.35
262 0.47
263 0.56
264 0.64
265 0.73
266 0.77
267 0.81
268 0.85
269 0.85
270 0.81
271 0.76
272 0.73
273 0.73
274 0.68
275 0.61
276 0.53
277 0.44
278 0.36
279 0.31
280 0.23
281 0.14
282 0.11
283 0.11
284 0.11
285 0.12
286 0.15
287 0.17
288 0.21
289 0.2
290 0.27
291 0.35
292 0.42
293 0.43
294 0.47
295 0.52
296 0.57
297 0.64
298 0.62
299 0.57
300 0.57
301 0.58
302 0.56
303 0.5
304 0.41
305 0.33
306 0.27
307 0.25
308 0.19
309 0.16
310 0.12
311 0.12
312 0.13
313 0.13
314 0.14
315 0.12
316 0.13
317 0.15
318 0.15
319 0.14
320 0.13
321 0.13
322 0.11
323 0.13
324 0.1
325 0.08
326 0.08
327 0.09
328 0.12
329 0.16
330 0.17
331 0.15
332 0.15
333 0.16
334 0.16
335 0.16
336 0.14
337 0.1
338 0.12
339 0.12
340 0.11
341 0.11
342 0.1
343 0.08
344 0.08
345 0.08
346 0.06
347 0.06
348 0.07
349 0.08
350 0.11
351 0.12
352 0.13
353 0.15
354 0.19
355 0.2
356 0.19
357 0.2
358 0.17
359 0.18
360 0.17
361 0.15
362 0.14
363 0.13
364 0.13
365 0.11
366 0.11
367 0.09
368 0.1
369 0.1
370 0.09
371 0.08
372 0.08
373 0.09
374 0.1
375 0.1
376 0.1
377 0.1
378 0.08
379 0.09
380 0.1
381 0.08
382 0.08
383 0.08
384 0.08
385 0.12
386 0.17
387 0.2
388 0.24
389 0.26
390 0.27
391 0.29
392 0.3
393 0.34
394 0.34
395 0.34
396 0.31
397 0.35
398 0.35
399 0.34
400 0.36
401 0.34
402 0.29
403 0.25
404 0.24
405 0.19
406 0.2
407 0.27
408 0.27
409 0.23
410 0.23
411 0.27
412 0.27
413 0.31
414 0.3
415 0.25
416 0.26
417 0.27
418 0.27
419 0.28
420 0.28
421 0.25
422 0.24
423 0.21
424 0.16
425 0.14
426 0.15
427 0.12
428 0.11
429 0.13
430 0.12
431 0.14
432 0.18
433 0.18
434 0.16
435 0.19
436 0.2
437 0.22
438 0.22
439 0.21
440 0.21
441 0.23
442 0.28
443 0.3
444 0.28
445 0.24
446 0.24
447 0.23
448 0.2
449 0.16
450 0.12
451 0.1
452 0.1
453 0.1
454 0.12
455 0.12
456 0.13
457 0.13
458 0.13
459 0.12
460 0.12
461 0.14
462 0.13
463 0.12
464 0.12
465 0.14
466 0.16
467 0.16
468 0.15
469 0.12
470 0.17
471 0.18
472 0.2