Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2W1L8

Protein Details
Accession B2W1L8    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
138-169DHGEGPSQPQKHRRQRRKPSPNAYEKMPKQKKBasic
NLS Segment(s)
PositionSequence
148-169KHRRQRRKPSPNAYEKMPKQKK
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MAHFNTMASPQTISSRTATSPSGSRTMQSRPQPVLRLSAPSGVLRLRAEPSERRHIQWAEDVIDNEGMGKKSSKVCCIYHKPRAADESSDDDSSDSSSDSDSDSEPDNSTARPAGRIGGARGRRPHQRDHDDCGDVHDHGEGPSQPQKHRRQRRKPSPNAYEKMPKQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.21
4 0.23
5 0.24
6 0.22
7 0.24
8 0.25
9 0.28
10 0.26
11 0.26
12 0.27
13 0.32
14 0.38
15 0.41
16 0.44
17 0.44
18 0.49
19 0.52
20 0.5
21 0.49
22 0.42
23 0.4
24 0.34
25 0.32
26 0.29
27 0.24
28 0.24
29 0.19
30 0.2
31 0.16
32 0.17
33 0.15
34 0.16
35 0.19
36 0.24
37 0.29
38 0.37
39 0.38
40 0.39
41 0.43
42 0.42
43 0.4
44 0.39
45 0.35
46 0.27
47 0.27
48 0.25
49 0.2
50 0.19
51 0.17
52 0.12
53 0.11
54 0.09
55 0.08
56 0.09
57 0.1
58 0.16
59 0.18
60 0.22
61 0.25
62 0.27
63 0.35
64 0.44
65 0.49
66 0.51
67 0.55
68 0.52
69 0.5
70 0.5
71 0.43
72 0.35
73 0.29
74 0.26
75 0.23
76 0.22
77 0.2
78 0.17
79 0.15
80 0.15
81 0.12
82 0.07
83 0.05
84 0.05
85 0.05
86 0.06
87 0.07
88 0.06
89 0.08
90 0.09
91 0.1
92 0.11
93 0.12
94 0.12
95 0.11
96 0.12
97 0.13
98 0.11
99 0.12
100 0.11
101 0.11
102 0.13
103 0.15
104 0.16
105 0.22
106 0.26
107 0.3
108 0.35
109 0.38
110 0.45
111 0.48
112 0.54
113 0.56
114 0.63
115 0.62
116 0.65
117 0.67
118 0.6
119 0.56
120 0.51
121 0.43
122 0.33
123 0.28
124 0.21
125 0.15
126 0.13
127 0.16
128 0.13
129 0.16
130 0.21
131 0.25
132 0.3
133 0.39
134 0.5
135 0.57
136 0.69
137 0.75
138 0.8
139 0.88
140 0.94
141 0.96
142 0.96
143 0.96
144 0.95
145 0.94
146 0.87
147 0.84
148 0.83
149 0.8