Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M3MT04

Protein Details
Accession A0A5M3MT04    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
84-108ALQKLAHKRLRRRFVRRVIRWIKKHBasic
NLS Segment(s)
PositionSequence
79-107KALRKALQKLAHKRLRRRFVRRVIRWIKK
Subcellular Location(s) cyto 10, nucl 7, mito 7, mito_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039373  Peptidase_M28B  
IPR007365  TFR-like_dimer_dom  
IPR036757  TFR-like_dimer_dom_sf  
KEGG cput:CONPUDRAFT_164921  -  
Pfam View protein in Pfam  
PF04253  TFR_dimer  
Amino Acid Sequences MLVAVAKHLGLLSLRLADSIILPLNTTHYANELEVYVDTVEAAAATNDHDLSFATLRRSIVSLQEASAALDSEKASAEKALRKALQKLAHKRLRRRFVRRVIRWIKKHLGLEVDPIGPKDAEPYEHDHLLDHSLKMLSARAGDVERLEKRWGKGPLHDLIQAAKRVRKVNAKLAKFEQGFISEDGIRSRNWYKHLGVAPGRYLGYGATTLPALTEAVIFDRNASLIRLEEDRLIALIDSMAQNLLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.12
4 0.11
5 0.11
6 0.12
7 0.13
8 0.1
9 0.11
10 0.11
11 0.14
12 0.16
13 0.16
14 0.14
15 0.14
16 0.16
17 0.15
18 0.16
19 0.13
20 0.12
21 0.11
22 0.12
23 0.1
24 0.08
25 0.07
26 0.06
27 0.06
28 0.05
29 0.05
30 0.03
31 0.04
32 0.05
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.09
39 0.11
40 0.12
41 0.14
42 0.16
43 0.16
44 0.17
45 0.18
46 0.16
47 0.18
48 0.2
49 0.19
50 0.16
51 0.18
52 0.17
53 0.16
54 0.15
55 0.12
56 0.08
57 0.09
58 0.08
59 0.07
60 0.08
61 0.07
62 0.07
63 0.09
64 0.12
65 0.16
66 0.18
67 0.23
68 0.26
69 0.29
70 0.33
71 0.38
72 0.42
73 0.46
74 0.53
75 0.58
76 0.62
77 0.66
78 0.72
79 0.75
80 0.78
81 0.79
82 0.78
83 0.78
84 0.81
85 0.85
86 0.81
87 0.82
88 0.82
89 0.81
90 0.77
91 0.74
92 0.69
93 0.62
94 0.58
95 0.49
96 0.42
97 0.33
98 0.32
99 0.26
100 0.22
101 0.17
102 0.16
103 0.15
104 0.11
105 0.1
106 0.1
107 0.08
108 0.08
109 0.1
110 0.15
111 0.17
112 0.18
113 0.18
114 0.16
115 0.16
116 0.18
117 0.17
118 0.12
119 0.1
120 0.1
121 0.1
122 0.1
123 0.1
124 0.07
125 0.06
126 0.06
127 0.07
128 0.07
129 0.08
130 0.08
131 0.12
132 0.13
133 0.14
134 0.18
135 0.2
136 0.2
137 0.27
138 0.32
139 0.29
140 0.33
141 0.35
142 0.36
143 0.35
144 0.35
145 0.29
146 0.26
147 0.28
148 0.28
149 0.25
150 0.25
151 0.27
152 0.29
153 0.33
154 0.39
155 0.41
156 0.47
157 0.53
158 0.53
159 0.53
160 0.53
161 0.57
162 0.48
163 0.44
164 0.35
165 0.28
166 0.28
167 0.24
168 0.24
169 0.16
170 0.16
171 0.17
172 0.17
173 0.15
174 0.17
175 0.22
176 0.23
177 0.26
178 0.3
179 0.3
180 0.36
181 0.4
182 0.42
183 0.41
184 0.4
185 0.38
186 0.35
187 0.34
188 0.26
189 0.23
190 0.15
191 0.13
192 0.11
193 0.09
194 0.08
195 0.08
196 0.07
197 0.07
198 0.08
199 0.06
200 0.06
201 0.06
202 0.06
203 0.08
204 0.1
205 0.09
206 0.1
207 0.1
208 0.1
209 0.11
210 0.11
211 0.1
212 0.1
213 0.13
214 0.14
215 0.15
216 0.16
217 0.16
218 0.16
219 0.15
220 0.14
221 0.11
222 0.1
223 0.08
224 0.09
225 0.08
226 0.08