Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MI20

Protein Details
Accession A0A5M3MI20    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
26-47TAGAKTKKPRTRVPMKKPDVTNHydrophilic
130-150LYSMPPARRLRRPARLPNFLPHydrophilic
NLS Segment(s)
PositionSequence
33-34KP
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
KEGG cput:CONPUDRAFT_138190  -  
Amino Acid Sequences MTSPLNNAVTNTPTATVPAKRSCDDTAGAKTKKPRTRVPMKKPDVTNAQSLWCDEVWWKDNGGTGIQKEYQTEWKALPATEKAVSLLFVGINYTNVFLGFPEEVQLSQVAPLHDPIPASRQLNFLTIRALYSMPPARRLRRPARLPNFLPIPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.22
4 0.26
5 0.31
6 0.35
7 0.35
8 0.39
9 0.38
10 0.37
11 0.36
12 0.34
13 0.36
14 0.4
15 0.4
16 0.4
17 0.46
18 0.53
19 0.56
20 0.58
21 0.58
22 0.59
23 0.69
24 0.76
25 0.79
26 0.8
27 0.81
28 0.82
29 0.75
30 0.71
31 0.69
32 0.6
33 0.53
34 0.43
35 0.39
36 0.31
37 0.3
38 0.26
39 0.17
40 0.15
41 0.12
42 0.15
43 0.15
44 0.15
45 0.15
46 0.13
47 0.15
48 0.15
49 0.16
50 0.14
51 0.12
52 0.14
53 0.15
54 0.15
55 0.14
56 0.15
57 0.19
58 0.18
59 0.19
60 0.17
61 0.17
62 0.18
63 0.17
64 0.17
65 0.12
66 0.13
67 0.13
68 0.13
69 0.11
70 0.1
71 0.11
72 0.09
73 0.08
74 0.06
75 0.05
76 0.05
77 0.05
78 0.06
79 0.05
80 0.06
81 0.05
82 0.05
83 0.05
84 0.05
85 0.07
86 0.06
87 0.06
88 0.07
89 0.07
90 0.07
91 0.08
92 0.08
93 0.06
94 0.07
95 0.1
96 0.09
97 0.09
98 0.1
99 0.1
100 0.11
101 0.11
102 0.11
103 0.12
104 0.17
105 0.18
106 0.18
107 0.21
108 0.21
109 0.25
110 0.26
111 0.23
112 0.2
113 0.19
114 0.18
115 0.17
116 0.16
117 0.12
118 0.18
119 0.25
120 0.24
121 0.32
122 0.39
123 0.44
124 0.52
125 0.62
126 0.64
127 0.68
128 0.76
129 0.79
130 0.82
131 0.85
132 0.79
133 0.78