Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MED8

Protein Details
Accession A0A5M3MED8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-23ATTSRRSSTARRSRPRLGSARCHydrophilic
NLS Segment(s)
PositionSequence
13-17RSRPR
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 8, cyto 4.5
Family & Domain DBs
KEGG cput:CONPUDRAFT_108843  -  
PROSITE View protein in PROSITE  
PS50007  PIPLC_X_DOMAIN  
Amino Acid Sequences MATTSRRSSTARRSRPRLGSARCARRSRSTHSLLRRIRSSSPPRYTARCSGRTRWRRSVFGDTLVTAPVEGKVKIEQLPSPEDLKGRGTAEDEECVFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.82
4 0.8
5 0.76
6 0.76
7 0.76
8 0.78
9 0.78
10 0.74
11 0.7
12 0.69
13 0.68
14 0.65
15 0.64
16 0.6
17 0.59
18 0.63
19 0.69
20 0.64
21 0.64
22 0.59
23 0.54
24 0.51
25 0.52
26 0.53
27 0.53
28 0.53
29 0.53
30 0.53
31 0.54
32 0.54
33 0.53
34 0.52
35 0.5
36 0.49
37 0.51
38 0.59
39 0.64
40 0.68
41 0.69
42 0.67
43 0.63
44 0.64
45 0.64
46 0.56
47 0.5
48 0.44
49 0.34
50 0.3
51 0.26
52 0.21
53 0.13
54 0.11
55 0.09
56 0.09
57 0.08
58 0.09
59 0.1
60 0.13
61 0.15
62 0.17
63 0.17
64 0.19
65 0.23
66 0.24
67 0.25
68 0.24
69 0.23
70 0.23
71 0.23
72 0.23
73 0.21
74 0.2
75 0.2
76 0.23
77 0.24
78 0.26