Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M3M924

Protein Details
Accession A0A5M3M924    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
52-77LLRKTRPLPFARYRRQRNHHDFDCGQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, E.R. 6, extr 5, plas 4, cyto_mito 4, mito_nucl 4
Family & Domain DBs
KEGG cput:CONPUDRAFT_140068  -  
Amino Acid Sequences MNLMKPSYTRTGNRIPIASLFAMCLCSTCVERLTEVVLEFMVPSFVTLVPGLLRKTRPLPFARYRRQRNHHDFDCGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.43
3 0.38
4 0.38
5 0.32
6 0.23
7 0.16
8 0.13
9 0.13
10 0.11
11 0.1
12 0.07
13 0.08
14 0.09
15 0.09
16 0.11
17 0.1
18 0.1
19 0.1
20 0.11
21 0.1
22 0.09
23 0.09
24 0.07
25 0.06
26 0.06
27 0.05
28 0.04
29 0.03
30 0.03
31 0.04
32 0.04
33 0.05
34 0.05
35 0.06
36 0.06
37 0.09
38 0.1
39 0.13
40 0.14
41 0.16
42 0.23
43 0.27
44 0.32
45 0.34
46 0.42
47 0.49
48 0.58
49 0.66
50 0.71
51 0.77
52 0.81
53 0.85
54 0.88
55 0.88
56 0.87
57 0.82