Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MX98

Protein Details
Accession A0A5M3MX98    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
49-78ERCDLREKIRKSKAKKKALKAASKRKEAMKBasic
NLS Segment(s)
PositionSequence
55-76EKIRKSKAKKKALKAASKRKEA
Subcellular Location(s) mito 16, mito_nucl 13.5, nucl 9
Family & Domain DBs
KEGG cput:CONPUDRAFT_89204  -  
Amino Acid Sequences MPAGGSHLRRLMSSTARRSRVDEAWSATKGSWRRTTNFPLFFTNEWREERCDLREKIRKSKAKKKALKAASKRKEAMKGYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.54
4 0.55
5 0.56
6 0.56
7 0.51
8 0.46
9 0.4
10 0.36
11 0.36
12 0.35
13 0.32
14 0.27
15 0.27
16 0.27
17 0.29
18 0.32
19 0.31
20 0.34
21 0.38
22 0.46
23 0.49
24 0.5
25 0.46
26 0.41
27 0.41
28 0.38
29 0.37
30 0.33
31 0.28
32 0.26
33 0.26
34 0.25
35 0.25
36 0.27
37 0.27
38 0.31
39 0.3
40 0.38
41 0.45
42 0.47
43 0.55
44 0.63
45 0.67
46 0.68
47 0.77
48 0.78
49 0.8
50 0.84
51 0.84
52 0.84
53 0.86
54 0.87
55 0.87
56 0.88
57 0.87
58 0.86
59 0.81
60 0.77
61 0.76