Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MBZ4

Protein Details
Accession A0A5M3MBZ4   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-39ESAPMRFWRIPRPKRRYLKKQLPLLKEESHydrophilic
NLS Segment(s)
PositionSequence
22-26RPKRR
Subcellular Location(s) nucl 9, cyto_nucl 9, cyto 7, mito 6, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045121  CoAse  
IPR015797  NUDIX_hydrolase-like_dom_sf  
IPR000086  NUDIX_hydrolase_dom  
Gene Ontology GO:0010945  F:CoA pyrophosphatase activity  
KEGG cput:CONPUDRAFT_111438  -  
Pfam View protein in Pfam  
PF00293  NUDIX  
PROSITE View protein in PROSITE  
PS51462  NUDIX  
CDD cd03426  CoAse  
Amino Acid Sequences MSSDDETSSGESAPMRFWRIPRPKRRYLKKQLPLLKEESRICIENFLDYRAARTRAEFPRSRSAAVLIALFVGREGDLYVLLSRRAAELRTYAGDTALPGGKVEPEDRSIEDTARREAYEEIGLPQDRVKVPLLCVMEPFLARNQVIVTPVVVLILDKTLQPQLNGFEVATLFSHPLRSFLDSTPPFPAPRSEPYHTWSDHAFGETGTTRVHRFLTGREAGGIKPVFGLTANILVAAASLGYGRPPSFEAQPPNAPTPRQQIARAIIMPGSALNEACRTEGISPDDAAGRLLRPPFAFNAPRVLEWARIGAQWDDLLSDDEDSPAPKAKPMIDATQLAVPAPTALADPASAADVVDAATRRGFVPPKIPTPPTPPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.24
3 0.27
4 0.3
5 0.39
6 0.49
7 0.59
8 0.66
9 0.71
10 0.76
11 0.83
12 0.91
13 0.91
14 0.92
15 0.92
16 0.9
17 0.92
18 0.9
19 0.86
20 0.81
21 0.78
22 0.72
23 0.68
24 0.61
25 0.56
26 0.51
27 0.46
28 0.4
29 0.38
30 0.32
31 0.31
32 0.3
33 0.27
34 0.27
35 0.24
36 0.28
37 0.29
38 0.32
39 0.26
40 0.28
41 0.35
42 0.4
43 0.48
44 0.49
45 0.5
46 0.57
47 0.59
48 0.57
49 0.49
50 0.42
51 0.36
52 0.32
53 0.26
54 0.16
55 0.14
56 0.12
57 0.11
58 0.09
59 0.06
60 0.05
61 0.05
62 0.05
63 0.04
64 0.05
65 0.06
66 0.07
67 0.08
68 0.09
69 0.09
70 0.09
71 0.11
72 0.12
73 0.12
74 0.12
75 0.13
76 0.16
77 0.17
78 0.18
79 0.16
80 0.15
81 0.15
82 0.13
83 0.14
84 0.13
85 0.11
86 0.09
87 0.1
88 0.1
89 0.12
90 0.13
91 0.12
92 0.13
93 0.15
94 0.16
95 0.19
96 0.19
97 0.2
98 0.23
99 0.23
100 0.24
101 0.24
102 0.22
103 0.2
104 0.2
105 0.2
106 0.17
107 0.16
108 0.14
109 0.16
110 0.16
111 0.15
112 0.15
113 0.17
114 0.16
115 0.17
116 0.19
117 0.16
118 0.17
119 0.22
120 0.23
121 0.19
122 0.19
123 0.18
124 0.17
125 0.15
126 0.16
127 0.12
128 0.12
129 0.12
130 0.12
131 0.11
132 0.11
133 0.11
134 0.11
135 0.09
136 0.07
137 0.07
138 0.07
139 0.06
140 0.05
141 0.04
142 0.04
143 0.05
144 0.04
145 0.05
146 0.09
147 0.09
148 0.1
149 0.11
150 0.12
151 0.13
152 0.13
153 0.12
154 0.09
155 0.08
156 0.09
157 0.08
158 0.07
159 0.06
160 0.06
161 0.08
162 0.08
163 0.1
164 0.1
165 0.13
166 0.14
167 0.14
168 0.23
169 0.21
170 0.23
171 0.24
172 0.24
173 0.22
174 0.2
175 0.22
176 0.17
177 0.22
178 0.27
179 0.27
180 0.27
181 0.3
182 0.34
183 0.32
184 0.3
185 0.25
186 0.2
187 0.18
188 0.17
189 0.14
190 0.09
191 0.1
192 0.09
193 0.1
194 0.08
195 0.09
196 0.09
197 0.1
198 0.11
199 0.11
200 0.11
201 0.13
202 0.19
203 0.2
204 0.19
205 0.19
206 0.2
207 0.18
208 0.23
209 0.2
210 0.13
211 0.12
212 0.12
213 0.1
214 0.1
215 0.1
216 0.05
217 0.07
218 0.07
219 0.06
220 0.06
221 0.06
222 0.06
223 0.05
224 0.04
225 0.02
226 0.02
227 0.03
228 0.03
229 0.04
230 0.04
231 0.05
232 0.07
233 0.1
234 0.13
235 0.18
236 0.22
237 0.26
238 0.31
239 0.33
240 0.37
241 0.36
242 0.34
243 0.33
244 0.35
245 0.37
246 0.35
247 0.33
248 0.34
249 0.35
250 0.38
251 0.35
252 0.29
253 0.23
254 0.2
255 0.18
256 0.13
257 0.11
258 0.08
259 0.07
260 0.07
261 0.09
262 0.09
263 0.1
264 0.1
265 0.09
266 0.1
267 0.14
268 0.16
269 0.16
270 0.16
271 0.16
272 0.17
273 0.16
274 0.16
275 0.13
276 0.1
277 0.12
278 0.13
279 0.15
280 0.14
281 0.16
282 0.18
283 0.25
284 0.27
285 0.25
286 0.32
287 0.31
288 0.31
289 0.32
290 0.31
291 0.26
292 0.24
293 0.26
294 0.19
295 0.18
296 0.19
297 0.16
298 0.16
299 0.14
300 0.13
301 0.11
302 0.1
303 0.12
304 0.1
305 0.11
306 0.1
307 0.11
308 0.11
309 0.12
310 0.13
311 0.16
312 0.16
313 0.17
314 0.2
315 0.21
316 0.27
317 0.3
318 0.33
319 0.32
320 0.34
321 0.33
322 0.33
323 0.31
324 0.25
325 0.21
326 0.16
327 0.11
328 0.1
329 0.08
330 0.06
331 0.06
332 0.06
333 0.06
334 0.07
335 0.07
336 0.08
337 0.07
338 0.07
339 0.06
340 0.06
341 0.06
342 0.09
343 0.09
344 0.09
345 0.1
346 0.11
347 0.12
348 0.18
349 0.22
350 0.22
351 0.31
352 0.37
353 0.44
354 0.5
355 0.54
356 0.53