Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MK23

Protein Details
Accession A0A5M3MK23   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
154-174DTEDKVTRLERNRQERQRLGYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 8, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009991  DCTN3  
Gene Ontology GO:0005869  C:dynactin complex  
GO:0061640  P:cytoskeleton-dependent cytokinesis  
KEGG cput:CONPUDRAFT_167124  -  
Pfam View protein in Pfam  
PF07426  Dynactin_p22  
Amino Acid Sequences MRRASDVQRKLGTLADVHDGLRKFIAQYDAHAELLTPAFALSGTLPSAAAAGYESMAPEELDAFLADMEPDVRAADRDMREIEALEAKGVTGAGKLADYKALEPRLEALITAHEEDVELAASLEQRIAALVDRHSTHVDALSELFVAWDDLLTDTEDKVTRLERNRQERQRLGYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.2
4 0.19
5 0.23
6 0.21
7 0.2
8 0.19
9 0.18
10 0.14
11 0.17
12 0.22
13 0.17
14 0.19
15 0.24
16 0.25
17 0.25
18 0.24
19 0.21
20 0.17
21 0.17
22 0.14
23 0.08
24 0.05
25 0.05
26 0.05
27 0.06
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.05
36 0.05
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.04
46 0.05
47 0.04
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.03
57 0.03
58 0.04
59 0.04
60 0.04
61 0.05
62 0.1
63 0.11
64 0.13
65 0.13
66 0.14
67 0.14
68 0.14
69 0.14
70 0.11
71 0.1
72 0.08
73 0.08
74 0.07
75 0.06
76 0.06
77 0.05
78 0.03
79 0.03
80 0.03
81 0.04
82 0.04
83 0.04
84 0.06
85 0.06
86 0.07
87 0.12
88 0.14
89 0.13
90 0.13
91 0.15
92 0.15
93 0.14
94 0.13
95 0.09
96 0.09
97 0.1
98 0.11
99 0.09
100 0.08
101 0.08
102 0.08
103 0.07
104 0.06
105 0.04
106 0.04
107 0.04
108 0.05
109 0.05
110 0.05
111 0.04
112 0.04
113 0.04
114 0.04
115 0.06
116 0.07
117 0.08
118 0.12
119 0.13
120 0.15
121 0.16
122 0.16
123 0.15
124 0.16
125 0.16
126 0.13
127 0.13
128 0.11
129 0.1
130 0.09
131 0.09
132 0.06
133 0.06
134 0.05
135 0.05
136 0.05
137 0.06
138 0.07
139 0.08
140 0.09
141 0.09
142 0.12
143 0.13
144 0.13
145 0.14
146 0.17
147 0.23
148 0.3
149 0.4
150 0.47
151 0.56
152 0.66
153 0.74
154 0.8
155 0.8