Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WJR7

Protein Details
Accession B2WJR7   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPPKRSSDRSTGPKKRVKNSSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPPKRSSDRSTGPKKRVKNSSASQLSQPSQPEQPEQYTPILSSSRDLDTVEESFEYRLLSQIADAAVDTAVDLSRDGTQALTPLATDASDFTDLNGWFEDRYEGLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.81
4 0.75
5 0.73
6 0.69
7 0.71
8 0.7
9 0.64
10 0.58
11 0.53
12 0.51
13 0.45
14 0.41
15 0.33
16 0.3
17 0.29
18 0.29
19 0.26
20 0.28
21 0.26
22 0.27
23 0.25
24 0.21
25 0.2
26 0.19
27 0.17
28 0.14
29 0.13
30 0.13
31 0.13
32 0.13
33 0.13
34 0.11
35 0.12
36 0.12
37 0.11
38 0.09
39 0.08
40 0.08
41 0.08
42 0.07
43 0.05
44 0.06
45 0.06
46 0.06
47 0.05
48 0.06
49 0.06
50 0.05
51 0.05
52 0.05
53 0.04
54 0.04
55 0.04
56 0.03
57 0.03
58 0.04
59 0.04
60 0.05
61 0.06
62 0.06
63 0.07
64 0.07
65 0.07
66 0.08
67 0.08
68 0.07
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.09
76 0.11
77 0.11
78 0.11
79 0.16
80 0.16
81 0.18
82 0.18
83 0.16
84 0.14
85 0.15
86 0.16