Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M3N1I7

Protein Details
Accession A0A5M3N1I7    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
195-223SSASHPQVPGKRPRGRPKGSKNRGGKAGAHydrophilic
NLS Segment(s)
PositionSequence
204-221GKRPRGRPKGSKNRGGKA
Subcellular Location(s) nucl 14, cyto_nucl 11.5, cyto 7, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR018482  Znf-C4H2  
KEGG cput:CONPUDRAFT_134674  -  
Pfam View protein in Pfam  
PF10146  zf-C4H2  
Amino Acid Sequences MSTDGNHNANHGNGTVAPQATTTHAMGVSHGPPLVATGDWTKDLVQLAKTAELKKHALTLQLQTAHIMSTHDALDQKDKAIQDIKEQKNKLDSERTRLLNCLAEINADRDKVDMLEVSIQRECTELRQKITTLEEGEYKTAKADVDRLRQELGQPPLPPLQTLLDERSSQYLQERRVNGEKRPAEDVVPLEVSASSASHPQVPGKRPRGRPKGSKNRGGKAGASVASASGLAASAAGTGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.17
4 0.16
5 0.15
6 0.16
7 0.17
8 0.2
9 0.17
10 0.15
11 0.15
12 0.15
13 0.16
14 0.18
15 0.16
16 0.15
17 0.14
18 0.12
19 0.11
20 0.13
21 0.13
22 0.09
23 0.1
24 0.11
25 0.13
26 0.14
27 0.14
28 0.14
29 0.14
30 0.16
31 0.17
32 0.15
33 0.16
34 0.16
35 0.2
36 0.24
37 0.24
38 0.25
39 0.27
40 0.28
41 0.26
42 0.3
43 0.26
44 0.26
45 0.27
46 0.28
47 0.29
48 0.29
49 0.28
50 0.24
51 0.23
52 0.2
53 0.17
54 0.14
55 0.09
56 0.08
57 0.09
58 0.09
59 0.11
60 0.12
61 0.16
62 0.16
63 0.16
64 0.17
65 0.17
66 0.18
67 0.21
68 0.21
69 0.25
70 0.35
71 0.41
72 0.46
73 0.47
74 0.46
75 0.48
76 0.49
77 0.44
78 0.44
79 0.39
80 0.39
81 0.45
82 0.46
83 0.4
84 0.39
85 0.37
86 0.29
87 0.27
88 0.21
89 0.14
90 0.13
91 0.13
92 0.15
93 0.14
94 0.12
95 0.12
96 0.1
97 0.11
98 0.09
99 0.09
100 0.06
101 0.05
102 0.1
103 0.1
104 0.12
105 0.12
106 0.12
107 0.12
108 0.13
109 0.12
110 0.12
111 0.2
112 0.2
113 0.22
114 0.24
115 0.24
116 0.25
117 0.27
118 0.24
119 0.17
120 0.16
121 0.17
122 0.16
123 0.17
124 0.15
125 0.13
126 0.12
127 0.11
128 0.1
129 0.08
130 0.15
131 0.19
132 0.26
133 0.29
134 0.3
135 0.3
136 0.3
137 0.32
138 0.31
139 0.29
140 0.26
141 0.24
142 0.25
143 0.27
144 0.27
145 0.25
146 0.2
147 0.17
148 0.16
149 0.18
150 0.18
151 0.18
152 0.18
153 0.19
154 0.21
155 0.19
156 0.17
157 0.22
158 0.24
159 0.27
160 0.33
161 0.34
162 0.36
163 0.45
164 0.48
165 0.45
166 0.5
167 0.48
168 0.45
169 0.47
170 0.43
171 0.35
172 0.34
173 0.32
174 0.25
175 0.22
176 0.19
177 0.15
178 0.14
179 0.13
180 0.11
181 0.09
182 0.07
183 0.09
184 0.1
185 0.12
186 0.13
187 0.19
188 0.26
189 0.33
190 0.42
191 0.5
192 0.58
193 0.65
194 0.76
195 0.8
196 0.82
197 0.86
198 0.87
199 0.89
200 0.89
201 0.89
202 0.87
203 0.84
204 0.82
205 0.75
206 0.65
207 0.58
208 0.55
209 0.45
210 0.38
211 0.3
212 0.23
213 0.2
214 0.18
215 0.13
216 0.07
217 0.06
218 0.05
219 0.04
220 0.04