Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2W8H3

Protein Details
Accession B2W8H3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-70FVTSKMYPKKKDPNAKPKILGFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, E.R. 6, mito 4, cyto 2, golg 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGSSFDFLAPILTPAALRSVQADGRPVITLFLVIFGLSIFGTVIWYVHFVTSKMYPKKKDPNAKPKILGFISR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.1
3 0.09
4 0.09
5 0.1
6 0.12
7 0.14
8 0.14
9 0.16
10 0.14
11 0.15
12 0.15
13 0.14
14 0.11
15 0.09
16 0.09
17 0.06
18 0.06
19 0.05
20 0.04
21 0.04
22 0.04
23 0.04
24 0.03
25 0.04
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.05
33 0.05
34 0.06
35 0.07
36 0.07
37 0.09
38 0.15
39 0.24
40 0.31
41 0.38
42 0.42
43 0.5
44 0.61
45 0.68
46 0.74
47 0.76
48 0.79
49 0.81
50 0.85
51 0.81
52 0.74
53 0.72