Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2W479

Protein Details
Accession B2W479   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-42LEQKLVKEKKRVEERQKAEREKVEKERRKGEKREKEKTRGABasic
NLS Segment(s)
PositionSequence
8-74KEKKRVEERQKAEREKVEKERRKGEKREKEKTRGAVAGKQAKGVVPVKTAGKKVVVMPKTGGGGKKK
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
Amino Acid Sequences MLEQKLVKEKKRVEERQKAEREKVEKERRKGEKREKEKTRGAVAGKQAKGVVPVKTAGKKVVVMPKTGGGGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.82
4 0.85
5 0.81
6 0.76
7 0.73
8 0.67
9 0.64
10 0.67
11 0.68
12 0.66
13 0.67
14 0.7
15 0.73
16 0.77
17 0.8
18 0.8
19 0.79
20 0.8
21 0.85
22 0.83
23 0.8
24 0.77
25 0.71
26 0.64
27 0.58
28 0.5
29 0.44
30 0.44
31 0.44
32 0.39
33 0.36
34 0.32
35 0.28
36 0.3
37 0.29
38 0.23
39 0.16
40 0.19
41 0.23
42 0.27
43 0.28
44 0.25
45 0.24
46 0.25
47 0.29
48 0.36
49 0.33
50 0.31
51 0.32
52 0.32
53 0.34
54 0.35