Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3N6Y1

Protein Details
Accession A0A5M3N6Y1   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
19-43QDGGIVKKKKKSKSKSTSDDAKRREBasic
NLS Segment(s)
PositionSequence
24-48VKKKKKSKSKSTSDDAKRREREKVK
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
KEGG cput:CONPUDRAFT_116048  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MSDYNFKPGGSLKLKGSVQDGGIVKKKKKSKSKSTSDDAKRREREKVKELLLKDEEGSPRDSPSGSGRNSPAVGGSNDRKTDAEKRFEEAQRRRLAERVAKMANKTHKDRVNEFNTKLEALSEHHDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.37
4 0.3
5 0.26
6 0.29
7 0.29
8 0.26
9 0.33
10 0.38
11 0.39
12 0.44
13 0.52
14 0.55
15 0.64
16 0.68
17 0.72
18 0.77
19 0.83
20 0.84
21 0.84
22 0.85
23 0.84
24 0.83
25 0.78
26 0.77
27 0.74
28 0.69
29 0.71
30 0.68
31 0.66
32 0.64
33 0.64
34 0.61
35 0.59
36 0.57
37 0.54
38 0.47
39 0.4
40 0.34
41 0.3
42 0.25
43 0.21
44 0.23
45 0.17
46 0.16
47 0.16
48 0.15
49 0.12
50 0.16
51 0.2
52 0.18
53 0.2
54 0.2
55 0.21
56 0.21
57 0.2
58 0.16
59 0.12
60 0.12
61 0.14
62 0.16
63 0.18
64 0.19
65 0.2
66 0.19
67 0.21
68 0.29
69 0.31
70 0.35
71 0.32
72 0.36
73 0.43
74 0.47
75 0.54
76 0.52
77 0.54
78 0.54
79 0.56
80 0.52
81 0.49
82 0.51
83 0.48
84 0.46
85 0.44
86 0.43
87 0.43
88 0.44
89 0.47
90 0.5
91 0.5
92 0.51
93 0.53
94 0.53
95 0.57
96 0.6
97 0.62
98 0.63
99 0.63
100 0.6
101 0.57
102 0.52
103 0.47
104 0.41
105 0.33
106 0.25
107 0.2
108 0.22
109 0.21
110 0.22
111 0.23
112 0.25
113 0.24