Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MHX9

Protein Details
Accession A0A5M3MHX9   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-36ASLRPVKTARHRSRIRLRSIRHRCRICHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 8, cyto 5
Family & Domain DBs
KEGG cput:CONPUDRAFT_138158  -  
Amino Acid Sequences MHADLEQLGASLRPVKTARHRSRIRLRSIRHRCRICLHAIFSIRTIKSCVENKPYPLTSGHTSRSPPFAPIGWRGSSARCTHILHVQEGAAKTPNPLCNPHHLTLLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.25
3 0.35
4 0.46
5 0.54
6 0.59
7 0.65
8 0.7
9 0.8
10 0.81
11 0.81
12 0.79
13 0.77
14 0.77
15 0.83
16 0.83
17 0.82
18 0.78
19 0.71
20 0.68
21 0.65
22 0.61
23 0.55
24 0.47
25 0.43
26 0.41
27 0.38
28 0.34
29 0.35
30 0.28
31 0.23
32 0.22
33 0.17
34 0.21
35 0.24
36 0.26
37 0.28
38 0.3
39 0.32
40 0.35
41 0.34
42 0.3
43 0.27
44 0.27
45 0.23
46 0.25
47 0.25
48 0.22
49 0.24
50 0.24
51 0.27
52 0.24
53 0.22
54 0.19
55 0.19
56 0.2
57 0.22
58 0.25
59 0.21
60 0.23
61 0.23
62 0.24
63 0.27
64 0.26
65 0.24
66 0.24
67 0.26
68 0.26
69 0.31
70 0.31
71 0.27
72 0.27
73 0.24
74 0.24
75 0.23
76 0.22
77 0.19
78 0.17
79 0.18
80 0.22
81 0.27
82 0.26
83 0.31
84 0.32
85 0.4
86 0.47
87 0.46
88 0.49